RegulonDB RegulonDB 10.9: Gene Form
   

ppk gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ppk ppx purN terminator anti-terminator anti-anti-terminator TSS_2782 (cluster) TSS_2782 (cluster) TSS_2781 (cluster) TSS_2781 (cluster) ppkp6 ppkp6 ppkp ppkp ppkp5 ppkp5

Gene      
Name: ppk    Texpresso search in the literature
Synonym(s): ECK2497, EG11510, b2501
Genome position(nucleotides): 2623044 --> 2625110 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.86
External database links:  
ASAP:
ABE-0008235
CGSC:
32894
ECHOBASE:
EB1472
ECOLIHUB:
ppk
OU-MICROARRAY:
b2501
STRING:
511145.b2501
COLOMBOS: ppk


Product      
Name: polyphosphate kinase
Synonym(s): Ppk
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,outer membrane
Molecular weight: 80.431
Isoelectric point: 9.268
Motif(s):
 
Type Positions Sequence
435 -> 435 H
503 -> 674 LMVSPQNSRRLLYEMVDREIANAQQGLPSGITLKLNNLVDKGLVDRLYAASSSGVPVNLLVRGMCSLIPNLEGISDNIRAISIVDRYLEHDRVYIFENGGDKKVYLSSADWMTRNIDYRIEVATPLLDPRLKQRVLDIIDILFSDTVKARYIDKELSNRYVPRGNRRKVRAQ
119 -> 320 QQNWLRHYFKQYLRQHITPILINPDTDLVQFLKDDYTYLAVEIIRGDTIRYALLEIPSDKVPRFVNLPPEAPRRRKPMILLDNILRYCLDDIFKGFFDYDALNAYSMKMTRDAEYDLVHEMEASLMELMSSSLKQRLTAEPVRFVYQRDMPNALVEVLREKLTISRYDSIVPGGRYHNFKDFINFPNVGKANLVNKPLPRLR
380 -> 380 S
430 -> 464 PGLKIHAKLFLISRKENGEVVRYAHIGTGNFNEKT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0009358 - polyphosphate kinase complex
GO:0031241 - periplasmic side of cell outer membrane
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0016776 - phosphotransferase activity, phosphate group as acceptor
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0016778 - diphosphotransferase activity
GO:0008976 - polyphosphate kinase activity
GO:0042803 - protein homodimerization activity
GO:0043751 - polyphosphate:AMP phosphotransferase activity
biological_process GO:0016310 - phosphorylation
GO:0046777 - protein autophosphorylation
GO:0006799 - polyphosphate biosynthetic process
GO:0006757 - ATP generation from ADP
External database links:  
DIP:
DIP-36218N
ECOCYC:
PPK-MONOMER
ECOLIWIKI:
b2501
INTERPRO:
IPR036832
INTERPRO:
IPR041108
INTERPRO:
IPR036830
INTERPRO:
IPR025200
INTERPRO:
IPR025198
INTERPRO:
IPR024953
INTERPRO:
IPR003414
INTERPRO:
IPR001736
PANTHER:
PTHR30218
PDB:
1XDP
PDB:
1XDO
PFAM:
PF13090
PFAM:
PF02503
PFAM:
PF13089
PFAM:
PF17941
PRIDE:
P0A7B1
PRODB:
PRO_000023580
PROSITE:
PS50035
REFSEQ:
NP_416996
SMR:
P0A7B1
UNIPROT:
P0A7B1


Operon      
Name: ppk-ppx         
Operon arrangement:
Transcription unit        Promoter
ppk-ppx
ppk-ppx


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ppkp5 2622874 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ppkp6 2622990 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2781 (cluster) 2625007 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2782 (cluster) 2625014 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB