RegulonDB RegulonDB 10.9: Gene Form
   

satP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yaaW mog satP mbiA htgAp1 htgAp1 htgAp2 htgAp2

Gene      
Name: satP    Texpresso search in the literature
Synonym(s): ECK0010, EG11512, b0010, yaaH
Genome position(nucleotides): 9928 <-- 10494 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.09
External database links:  
ASAP:
ABE-0000032
ECHOBASE:
EB1474
ECOLIHUB:
yaaH
OU-MICROARRAY:
b0010
STRING:
511145.b0010
COLOMBOS: satP


Product      
Name: acetate/succinate:H+ symporter
Synonym(s): SatP, YaaH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 20.071
Isoelectric point: 8.448
Motif(s):
 
Type Positions Sequence
4 -> 177 TKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFYGGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLGLWGVFTLFMFFGTLKGARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGASAIYLAMGEVLNEQF
64 -> 84 FGLTAFTSYGSFWLTLVAILL
123 -> 143 VLQFVFFSLTVLFALLAIGNI
131 -> 131 L
164 -> 164 A

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015293 - symporter activity
GO:0015360 - acetate:proton symporter activity
biological_process GO:0006811 - ion transport
GO:0071422 - succinate transmembrane transport
GO:0035433 - acetate transmembrane transport
GO:1902600 - proton transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11512-MONOMER
ECOLIWIKI:
b0010
INTERPRO:
IPR000791
PDB:
5ZUG
PFAM:
PF01184
PRIDE:
P0AC98
PROSITE:
PS01114
REFSEQ:
NP_414551
SMR:
P0AC98
UNIPROT:
P0AC98


Operon      
Name: satP         
Operon arrangement:
Transcription unit        Promoter
satP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB