RegulonDB RegulonDB 10.9: Gene Form
   

yhcA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhcD gltF yhcA TSS_3550 TSS_3550 yhcAp9 yhcAp9 yhcAp1 yhcAp1 yhcAp11 yhcAp11

Gene      
Name: yhcA    Texpresso search in the literature
Synonym(s): ECK3205, EG11515, b3215
Genome position(nucleotides): 3362112 --> 3362786 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.63
External database links:  
ASAP:
ABE-0010552
ECHOBASE:
EB1477
ECOLIHUB:
yhcA
ECOO157CYC:
Z1537
ECOO157CYC:
Z4969
OU-MICROARRAY:
b3215
STRING:
511145.b3215
COLOMBOS: yhcA


Product      
Name: putative fimbrial chaperone YhcA
Synonym(s): YhcA
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 25.339
Isoelectric point: 9.502
Motif(s):
 
Type Positions Sequence
20 -> 224 TGMVPETSVLLVDEKRGEASINIKNTDDHPSLLYTTIVDLPESNKSIRLIPTQPVIRVEAGQVQQVRFLLQATVPLQSEELKRVTFEGIPPKDDKSSRVTVSIRQDLPVLIHPASLPEERETWKFLEWRKNGDQIEISNPSNYVVRMTLQFKTLPSGKTGAINKTYFLPHTSTTTALTNATDTKVEFYPASRYGYRGNKYVTDLK
204 -> 224 VEFYPASRYGYRGNKYVTDLK
24 -> 58 PETSVLLVDEKRGEASINIKNTDDHPSLLYTTIVD
1 -> 19 MLRHITFTVFITTSMNTLA
22 -> 135 MVPETSVLLVDEKRGEASINIKNTDDHPSLLYTTIVDLPESNKSIRLIPTQPVIRVEAGQVQQVRFLLQATVPLQSEELKRVTFEGIPPKDDKSSRVTVSIRQDLPVLIHPASL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
biological_process GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
EG11515-MONOMER
ECOLIWIKI:
b3215
ECOO157CYC:
Z1537-MONOMER
ECOO157CYC:
Z4969-MONOMER
INTERPRO:
IPR013783
INTERPRO:
IPR008962
INTERPRO:
IPR016147
INTERPRO:
IPR036316
MODBASE:
P28722
PFAM:
PF00345
PRIDE:
P28722
REFSEQ:
NP_417682
UNIPROT:
P28722


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yhcAp11 3361978 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yhcAp1 3362039 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yhcAp9 3362094 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_3550 3364436 forward nd [RS-EPT-CBR] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB