RegulonDB RegulonDB 10.9: Gene Form
   

ybfD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybfL ybfD ybgA ybfQ phr LexA LexA terminator phrp phrp ybgAp1 ybgAp1 ybgAp2 ybgAp2

Gene      
Name: ybfD    Texpresso search in the literature
Synonym(s): ECK0695, EG11524, b0706
Genome position(nucleotides): 738092 --> 738853 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
39.63
External database links:  
ASAP:
ABE-0002411
ECHOBASE:
EB1486
ECOLIHUB:
ybfD
ECOO157CYC:
Z0700
ECOO157CYC:
Z2254
ECOO157CYC:
Z2253
ECOO157CYC:
Z0854
ECOO157CYC:
Z0857
OU-MICROARRAY:
b0706
STRING:
511145.b0706
COLOMBOS: ybfD


Product      
Name: H repeat-associated putative transposase YbfD
Synonym(s): YbfD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.865
Isoelectric point: 6.186
Motif(s):
 
Type Positions Sequence
7 -> 94 MEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWEDIEDFGETHPDFLKQYGDFENGIPVHDTIARVVSCICPAKFHESFINWM
102 -> 232 DKDVIAIDGKIHRHSYDKSRRKGAIHVISAFSTMHSLVIGQIKTDKKSNEITAIPELLNMLDIKGKIIKTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPKHDSYAISEKSHGR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006313 - transposition, DNA-mediated
Note(s): Note(s): ...[more].
Reference(s): [1] Zhao S., et al., 1993
External database links:  
ECOCYC:
EG11524-MONOMER
ECOLIWIKI:
b0706
ECOO157CYC:
Z0700-MONOMER
ECOO157CYC:
Z2254-MONOMER
ECOO157CYC:
Z2253-MONOMER
ECOO157CYC:
Z0857-MONOMER
ECOO157CYC:
Z0854-MONOMER
INTERPRO:
IPR032806
INTERPRO:
IPR002559
PFAM:
PF01609
PFAM:
PF13808
PRIDE:
P28916
REFSEQ:
NP_415234
SMR:
P28916
UNIPROT:
P28916


Operon      
Name: ybfD         
Operon arrangement:
Transcription unit        Promoter
ybfD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Zhao S., Sandt CH., Feulner G., Vlazny DA., Gray JA., Hill CW., 1993, Rhs elements of Escherichia coli K-12: complex composites of shared and unique components that have different evolutionary histories., J Bacteriol 175(10):2799-808


RegulonDB