RegulonDB RegulonDB 10.9: Gene Form
   

ydcC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydcC yncI pptA yncO ydcD yddH terminator TSS_1826 TSS_1826 pptAp6 pptAp6 pptAp7 pptAp7

Gene      
Name: ydcC    Texpresso search in the literature
Synonym(s): ECK1454, EG11526, b1460
Genome position(nucleotides): 1531816 --> 1532952 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.78
External database links:  
ASAP:
ABE-0004872
ECHOBASE:
EB1488
ECOLIHUB:
ydcC
ECOO157CYC:
Z0700
ECOO157CYC:
Z2254
ECOO157CYC:
Z2253
ECOO157CYC:
Z0854
ECOO157CYC:
Z0857
OU-MICROARRAY:
b1460
STRING:
511145.b1460
COLOMBOS: ydcC


Product      
Name: H repeat-associated putative transposase YdcC
Synonym(s): YdcC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 43.079
Isoelectric point: 7.424
Motif(s):
 
Type Positions Sequence
102 -> 343 DKDVIAIDGKTLRHSYDKSRRRGAIHVISAFSTMHSLVIGQIKTDEKSNEITAIPELLNMLDIKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPAHDSYAMSEKSHGREEIRLHIVCDVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKELEMTVRYYISSADLTAEKFATAIRNHWHVENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIAINI
8 -> 94 GHISIIPDYRQAWKMEHKLSDILLLTICAVISGAEGWEDIEDFGETHPDFLKQYGDFENGIPVHDTIARVVSCISPAKFHECFINWM

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006313 - transposition, DNA-mediated
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11526-MONOMER
ECOLIWIKI:
b1460
ECOO157CYC:
Z0700-MONOMER
ECOO157CYC:
Z2254-MONOMER
ECOO157CYC:
Z2253-MONOMER
ECOO157CYC:
Z0857-MONOMER
ECOO157CYC:
Z0854-MONOMER
INTERPRO:
IPR032806
INTERPRO:
IPR002559
PFAM:
PF01609
PFAM:
PF13808
PRIDE:
P28917
REFSEQ:
NP_415977
SMR:
P28917
UNIPROT:
P28917


Operon      
Name: ydcC         
Operon arrangement:
Transcription unit        Promoter
ydcC


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter pptAp7 1532858 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter pptAp6 1532867 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1826 1533030 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB