RegulonDB RegulonDB 10.9: Gene Form
   

leuD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

leuC setA leuD TSS_128 TSS_128 TSS_127 TSS_127 TSS_126 TSS_126 TSS_125 TSS_125 TSS_124 TSS_124 leuDp4 leuDp4 TSS_123 TSS_123 TSS_122 TSS_122

Gene      
Name: leuD    Texpresso search in the literature
Synonym(s): ECK0073, EG11575, b0071
Genome position(nucleotides): 78848 <-- 79453 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.49
External database links:  
ASAP:
ABE-0000259
CGSC:
569
ECHOBASE:
EB1535
ECOLIHUB:
leuD
OU-MICROARRAY:
b0071
STRING:
511145.b0071
COLOMBOS: leuD


Product      
Name: 3-isopropylmalate dehydratase subunit LeuD
Synonym(s): 3-isopropylmalate dehydratase, small subunit, LeuD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.487
Isoelectric point: 5.029
Motif(s):
 
Type Positions Sequence
3 -> 126 EKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLDEKGQQPNPDFVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLLPVKLSD
2 -> 201 AEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLDEKGQQPNPDFVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLLPVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFTIDAFRRHCMMNGLDSIGLTLQHDDAIAAYEAKQPAFMN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.19 - leucine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009316 - 3-isopropylmalate dehydratase complex
molecular_function GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0003861 - 3-isopropylmalate dehydratase activity
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0009082 - branched-chain amino acid biosynthetic process
GO:0009098 - leucine biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10092N
ECOCYC:
LEUD-MONOMER
ECOLIWIKI:
b0071
INTERPRO:
IPR015928
INTERPRO:
IPR004431
INTERPRO:
IPR000573
INTERPRO:
IPR033940
MODBASE:
P30126
PFAM:
PF00694
PRIDE:
P30126
PRODB:
PRO_000023084
REFSEQ:
NP_414613
SMR:
P30126
UNIPROT:
P30126


Operon      
Name: leuLABCD         
Operon arrangement:
Transcription unit        Promoter
leuL
leuLABCD
leuLABCD


Transcriptional Regulation      
Display Regulation             
Activated by: LeuO


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_122 79281 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_123 79386 reverse nd [RS-EPT-CBR] [1]
  promoter leuDp4 79594 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_124 79955 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_125 80236 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_126 80442 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_127 80589 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_128 80670 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB