RegulonDB RegulonDB 10.9: Gene Form
   

sseB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pepB sseB ryfA IS128 C0614 ryfAp11 ryfAp11

Gene      
Name: sseB    Texpresso search in the literature
Synonym(s): ECK2519, EG11601, b2522
Genome position(nucleotides): 2654157 <-- 2654933 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.1
External database links:  
ASAP:
ABE-0008301
CGSC:
33026
ECHOBASE:
EB1558
ECOLIHUB:
sseB
OU-MICROARRAY:
b2522
STRING:
511145.b2522
COLOMBOS: sseB


Product      
Name: protein SseB
Synonym(s): SseB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.642
Isoelectric point: 4.177
Motif(s):
 
Type Positions Sequence
8 -> 119 LEDLLEKAATEPAHRPAFFRTLLESTVWVPGTAAQGEAVVEDSALDLQHWEKEDGTSVIPFFTSLEALQQAVEDEQAFVVMPVRTLFEMTLGETLFLNAKLPTGKEFMPREI
137 -> 243 EGGESLILSEVAEPPAQMIDSLTTLFKTIKPVKRAFICSIKENEEAQPNLLIGIEADGDIEEIIQATGSVATDTLPGDEPIDICQVKKGEKGISHFITEHIAPFYER

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Hama H., et al., 1994
External database links:  
ECOCYC:
EG11601-MONOMER
ECOLIWIKI:
b2522
INTERPRO:
IPR009839
INTERPRO:
IPR027945
PFAM:
PF14581
PFAM:
PF07179
PRIDE:
P0AFZ1
REFSEQ:
NP_417017
UNIPROT:
P0AFZ1


Operon      
Name: sseB         
Operon arrangement:
Transcription unit        Promoter
sseB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ryfAp11 2653699 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hama H., Kayahara T., Ogawa W., Tsuda M., Tsuchiya T., 1994, Enhancement of serine-sensitivity by a gene encoding rhodanese-like protein in Escherichia coli., J Biochem (Tokyo) 115(6):1135-40

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB