RegulonDB RegulonDB 10.9: Gene Form
   

baeR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mdtD baeS baeR yegP TSS_2404 TSS_2404

Gene      
Name: baeR    Texpresso search in the literature
Synonym(s): ECK2075, EG11618, b2079
Genome position(nucleotides): 2164276 --> 2164998 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.08
Note(s): An integrated transcriptomic study of the extracytoplasmic stress response, which detects and responds to alterations of the bacterial envelope, was performed by Bury-Mone et al. (2009). They investigated the interconnections and dynamics between Bae, Cpx, Psp, Rcs, and σE pathways and showed that these pathways can be activated simultaneously in response to exogenous or endogenous stimulation, while natural environmental stimuli provoke bacterial modifications that lead to multiple pathway responses 19763168
Each of these responses might be specialized to ensure a specific aspect of envelope biogenesis and maintenance; on the other hand, CpxR could have a role as a modulator of the response by integrating other endogenous signals. Bury-Mone et al. concluded that all five pathways are needed to mount a full response to extracytoplasmic stress 19763168
baeR mutant strains are capable of increasing the number of replication origins, the amount of DnaA protein per cell, and the growth rate 26681035
External database links:  
ASAP:
ABE-0006884
CGSC:
30764
ECHOBASE:
EB1575
ECOLIHUB:
baeR
OU-MICROARRAY:
b2079
STRING:
511145.b2079
COLOMBOS: baeR


Product      
Name: DNA-binding transcriptional activator BaeR
Synonym(s): BaeR, BaeR response regulator
Sequence: Get amino acid sequence Fasta Format
Regulator Family: OmpR
Cellular location: cytosol
Molecular weight: 27.656
Isoelectric point: 5.448
Motif(s):
 
Type Positions Sequence
131 -> 234 QRELQQQDAESPLIIDEGRFQASWRGKMLDLTPAEFRLLKTLSHEPGKVFSREQLLNHLYDDYRVVTDRTIDSHIKNLRRKLESLDAEQSFIRAVYGVGYRWEA
12 -> 125 RILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTPPDLILLDLMLPGTDGLTLCREIRRFSDIPIVMVTAKIEEIDRLLGLEIGADDYICKPYSPREVVARVKTIL
13 -> 121 ILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTPPDLILLDLMLPGTDGLTLCREIRRFSDIPIVMVTAKIEEIDRLLGLEIGADDYICKPYSPREVVARV
157 -> 231 KMLDLTPAEFRLLKTLSHEPGKVFSREQLLNHLYDDYRVVTDRTIDSHIKNLRRKLESLDAEQSFIRAVYGVGYR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000156 - phosphorelay response regulator activity
GO:0042802 - identical protein binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
GO:2000144 - positive regulation of DNA-templated transcription, initiation
GO:2001023 - regulation of response to drug
Evidence: [APPH] Assay of protein purified to homogeneity
[GEA] Gene expression analysis
Reference(s): [1] Baranova N., et al., 2002
[2] Pao GM., et al., 1995
[3] Parkinson JS. 1993
[4] Parkinson JS., et al., 1992
[5] Stock JB., et al., 1990
External database links:  
DIP:
DIP-9198N
ECOCYC:
BAER-MONOMER
ECOLIWIKI:
b2079
INTERPRO:
IPR001867
INTERPRO:
IPR036388
INTERPRO:
IPR039420
INTERPRO:
IPR016032
INTERPRO:
IPR011006
INTERPRO:
IPR001789
MODBASE:
P69228
PANTHER:
PTHR26402
PDB:
4B09
PFAM:
PF00486
PFAM:
PF00072
PRIDE:
P69228
PRODB:
PRO_000022196
PROSITE:
PS50110
PROSITE:
PS51755
REFSEQ:
NP_416583
SMART:
SM00862
SMART:
SM00448
SMR:
P69228
SWISSMODEL:
P69228
UNIPROT:
P69228


Operon      
Name: mdtABCD-baeSR         
Operon arrangement:
Transcription unit        Promoter
mdtABCD-baeSR
baeSR


Transcriptional Regulation      
Display Regulation             
Activated by: BaeR, CpxR
Growth Conditions:

[1] 

C: Escherichia coli| plasmid pBAD/Myc-HisA mutant| LB medium| 37.0 C| mid exponential phase
E: Escherichia coli| plasmid pBADBaeR (arabinose-induced baeR) mutant| LB medium| 37.0 C| mid exponential phase



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2404 2164246 forward nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Baranova N., Nikaido H., 2002, The baeSR two-component regulatory system activates transcription of the yegMNOB (mdtABCD) transporter gene cluster in Escherichia coli and increases its resistance to novobiocin and deoxycholate., J Bacteriol 184(15):4168-76

 [2] Pao GM., Saier MH., 1995, Response regulators of bacterial signal transduction systems: selective domain shuffling during evolution., J Mol Evol 40(2):136-54

 [3] Parkinson JS., 1993, Signal transduction schemes of bacteria., Cell 73(5):857-71

 [4] Parkinson JS., Kofoid EC., 1992, Communication modules in bacterial signaling proteins., Annu Rev Genet 26:71-112

 [5] Stock JB., Stock AM., Mottonen JM., 1990, Signal transduction in bacteria., Nature 344(6265):395-400

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB