RegulonDB RegulonDB 10.9: Gene Form
   

fliH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fliF fliI fliG fliH fliJ fliK

Gene      
Name: fliH    Texpresso search in the literature
Synonym(s): ECK1938, EG11656, b1940, flaAII.3, flaBIII
Genome position(nucleotides): 2015868 --> 2016554 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.06
External database links:  
ASAP:
ABE-0006458
CGSC:
18319
ECHOBASE:
EB1608
ECOLIHUB:
fliH
OU-MICROARRAY:
b1940
STRING:
511145.b1940
COLOMBOS: fliH


Product      
Name: flagellar biosynthesis protein FliH
Synonym(s): FliH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,cell projection
Molecular weight: 25.05
Isoelectric point: 4.368
Motif(s):
 
Type Positions Sequence
3 -> 3 D
96 -> 219 ARMQQLVSEFQTTLDALDSVIASRLMQMALEAARQVIGQTPTVDNSALIKQIQQLLQQEPLFSGKPQLRVHPDDLQRVDDMLGATLSLHGWRLRGDPTLHPGGCKVSADEGDLDASVATRWQEL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009288 - bacterial-type flagellum
molecular_function GO:0003774 - motor activity
biological_process GO:0015031 - protein transport
GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0044781 - bacterial-type flagellum organization
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9654N
ECOCYC:
EG11656-MONOMER
ECOLIWIKI:
b1940
INTERPRO:
IPR000563
INTERPRO:
IPR018035
PFAM:
PF02108
PRIDE:
P31068
PRINTS:
PR01003
PRODB:
PRO_000022659
REFSEQ:
NP_416450
SMR:
P31068
UNIPROT:
P31068


Operon      
Name: fliFGHIJK         
Operon arrangement:
Transcription unit        Promoter
fliFGHIJK
fliFGHIJK


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC
Repressed by: CsgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB