RegulonDB RegulonDB 10.9: Gene Form
   

atoS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rcsC atoS atoC atoD IHF IHF AtoC AtoC atoDp atoDp rcsCp4 rcsCp4 rcsCp5 rcsCp5 TSS_2501 TSS_2501 TSS_2500 TSS_2500 TSS_2499 TSS_2499 TSS_2498 TSS_2498 TSS_2497 TSS_2497

Gene      
Name: atoS    Texpresso search in the literature
Synonym(s): ECK2212, EG11667, b2219
Genome position(nucleotides): 2320043 --> 2321869 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.55
External database links:  
ASAP:
ABE-0007341
CGSC:
37061
ECHOBASE:
EB1618
ECOLIHUB:
atoS
OU-MICROARRAY:
b2219
STRING:
511145.b2219
COLOMBOS: atoS


Product      
Name: sensor histidine kinase AtoS
Synonym(s): AtoS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 67.79
Isoelectric point: 6.109
Motif(s):
 
Type Positions Sequence
190 -> 210 VRIIIVLTAGLLISLLLIVLF
326 -> 382 HGTEHVALEISFPGRDRTIELSVTTSRIHNTHGEMIGALVIFSDLTARKETQRRMAQ
389 -> 450 LGELMAGVAHEVRNPLTAIRGYVQILRQQTSDPIHQEYLSVVLKEIDSINKVIQQLLEFSRP
395 -> 602 GVAHEVRNPLTAIRGYVQILRQQTSDPIHQEYLSVVLKEIDSINKVIQQLLEFSRPRHSQWQQVSLNALVEETLVLVQTAGVQARVDFISELDNELSPINADRELLKQVLLNILINAVQAISARGKIRIQTWQYSDSQQAISIEDNGCGIDLSLQKKIFDPFFTTKASGTGLGLALSQRIINAHQGDIRVASLPGYGATFTLILPINP
496 -> 599 DRELLKQVLLNILINAVQAISARGKIRIQTWQYSDSQQAISIEDNGCGIDLSLQKKIFDPFFTTKASGTGLGLALSQRIINAHQGDIRVASLPGYGATFTLILP

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
GO:0042803 - protein homodimerization activity
biological_process GO:1904583 - response to polyamine macromolecule
GO:0006355 - regulation of transcription, DNA-templated
GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0023014 - signal transduction by protein phosphorylation
External database links:  
ECOCYC:
ATOS-MONOMER
ECOLIWIKI:
b2219
INTERPRO:
IPR000014
INTERPRO:
IPR036097
INTERPRO:
IPR035965
INTERPRO:
IPR013767
INTERPRO:
IPR005467
INTERPRO:
IPR004358
INTERPRO:
IPR003661
INTERPRO:
IPR036890
INTERPRO:
IPR000700
INTERPRO:
IPR003594
INTERPRO:
IPR003660
MODBASE:
Q06067
PFAM:
PF00512
PFAM:
PF00989
PFAM:
PF02518
PRIDE:
Q06067
PRINTS:
PR00344
PRODB:
PRO_000022185
PROSITE:
PS50885
PROSITE:
PS50113
PROSITE:
PS50109
PROSITE:
PS50112
REFSEQ:
NP_416723
SMART:
SM00388
SMART:
SM00091
SMART:
SM00304
SMART:
SM00387
SMR:
Q06067
UNIPROT:
Q06067


Operon      
Name: atoSC         
Operon arrangement:
Transcription unit        Promoter
atoSC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2497 2317398 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2498 2317454 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2499 2319113 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2500 2319298 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2501 2319911 reverse nd [RS-EPT-CBR] [1]
  promoter rcsCp5 2319979 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rcsCp4 2320081 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB