RegulonDB RegulonDB 10.9: Gene Form
   

yidG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

emrD yidF yidI yidG yidH TSS_4256 TSS_4256 TSS_4255 TSS_4255 TSS_4254 TSS_4254 yidFp5 yidFp5 TSS_4253 TSS_4253

Gene      
Name: yidG    Texpresso search in the literature
Synonym(s): ECK3666, EG11695, b3675
Genome position(nucleotides): 3855608 <-- 3855970 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.41
External database links:  
ASAP:
ABE-0012015
ECHOBASE:
EB1646
ECOLIHUB:
yidG
OU-MICROARRAY:
b3675
STRING:
511145.b3675
COLOMBOS: yidG


Product      
Name: inner membrane protein YidG
Synonym(s): YidG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 13.768
Isoelectric point: 11.038
Motif(s):
 
Type Positions Sequence
91 -> 113 FLISLAVLSLAILFAVTHIHQLI
22 -> 39 LAWFRTMLGYGALMALAI
49 -> 68 LFWISIGILAIVALILWHYT
12 -> 65 DPGLQPERTSLAWFRTMLGYGALMALAIKHNWHQAGMLFWISIGILAIVALILW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Savage DF., et al., 2007
External database links:  
ECOCYC:
EG11695-MONOMER
ECOLIWIKI:
b3675
INTERPRO:
IPR003807
PFAM:
PF02656
PRIDE:
P0ADL6
REFSEQ:
NP_418131
UNIPROT:
P0ADL6


Operon      
Name: yidHGF         
Operon arrangement:
Transcription unit        Promoter
yidHGF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4253 3855648 reverse nd [RS-EPT-CBR] [2]
  promoter yidFp5 3855790 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_4254 3855813 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4255 3856395 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4256 3856414 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Savage DF., Anderson CL., Robles-Colmenares Y., Newby ZE., Stroud RM., 2007, Cell-free complements in vivo expression of the E. coli membrane proteome., Protein Sci 16(5):966-76

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB