RegulonDB RegulonDB 10.9: Gene Form
   

yidH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yidF yidI yidG yidH TSS_4256 TSS_4256 TSS_4255 TSS_4255 TSS_4254 TSS_4254 yidFp5 yidFp5 TSS_4253 TSS_4253

Gene      
Name: yidH    Texpresso search in the literature
Synonym(s): ECK3667, EG11696, b3676
Genome position(nucleotides): 3855960 <-- 3856307 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.01
External database links:  
ASAP:
ABE-0012018
ECHOBASE:
EB1647
ECOLIHUB:
yidH
OU-MICROARRAY:
b3676
STRING:
511145.b3676
COLOMBOS: yidH


Product      
Name: DUF202 domain-containing inner membrane protein YidH
Synonym(s): YidH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 12.779
Isoelectric point: 9.063
Motif(s):
 
Type Positions Sequence
54 -> 74 LLALLLCLFSGGLAMYGYLRW
93 -> 113 LLIISLILMVVAVIVMGLVLY
13 -> 79 RFSLANERTFLAWIRTALGFLAAGVGLDQLAPDFATPVIRELLALLLCLFSGGLAMYGYLRWLRNEK
31 -> 51 GFLAAGVGLDQLAPDFATPVI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0006979 - response to oxidative stress
Note(s): Note(s): ...[more].
Reference(s): [1] Eichmann C., et al., 2014
External database links:  
DIP:
DIP-47894N
ECOCYC:
EG11696-MONOMER
ECOLIWIKI:
b3676
INTERPRO:
IPR003807
PFAM:
PF02656
PRIDE:
P0ADM0
REFSEQ:
NP_418132
UNIPROT:
P0ADM0


Operon      
Name: yidHGF         
Operon arrangement:
Transcription unit        Promoter
yidHGF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4253 3855648 reverse nd [RS-EPT-CBR] [2]
  promoter yidFp5 3855790 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_4254 3855813 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4255 3856395 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4256 3856414 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Eichmann C., Orts J., Tzitzilonis C., Vogeli B., Smrt S., Lorieau J., Riek R., 2014, Intermolecular detergent-membrane protein noes for the characterization of the dynamics of membrane protein-detergent complexes., J Phys Chem B 118(49):14288-301

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB