RegulonDB RegulonDB 10.9: Gene Form
   

udk gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcE udk dcd TSS_2402 TSS_2402

Gene      
Name: udk    Texpresso search in the literature
Synonym(s): ECK2060, EG11701, b2066
Genome position(nucleotides): 2142307 <-- 2142948 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.75
External database links:  
ASAP:
ABE-0006840
CGSC:
42
ECHOBASE:
EB1652
ECOLIHUB:
udk
OU-MICROARRAY:
b2066
STRING:
511145.b2066
COLOMBOS: udk


Product      
Name: uridine/cytidine kinase
Synonym(s): Udk
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.353
Isoelectric point: 6.883
Motif(s):
 
Type Positions Sequence
10 -> 199 IIGIAGASASGKSLIASTLYRELREQVGDEHIGVIPEDCYYKDQSHLSMEERVKTNYDHPSAMDHSLLLEHLQALKRGSAIDLPVYSYVEHTRMKETVTVEPKKVIILEGILLLTDARLRDELNFSIFVDTPLDICLMRRIKRDVNERGRSMDSVMAQYQKTVRPMFLQFIEPSKQYADIIVPRGGKNRI
15 -> 22 GASASGKS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004849 - uridine kinase activity
GO:0043771 - cytidine kinase activity
biological_process GO:0016310 - phosphorylation
GO:0008655 - pyrimidine-containing compound salvage
GO:0044206 - UMP salvage
GO:0044211 - CTP salvage
GO:0009224 - CMP biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Neuhard J., et al., 1993
External database links:  
DIP:
DIP-36012N
ECOCYC:
UDK-MONOMER
ECOLIWIKI:
b2066
INTERPRO:
IPR006083
INTERPRO:
IPR027417
INTERPRO:
IPR026008
INTERPRO:
IPR000764
MODBASE:
P0A8F4
PFAM:
PF00485
PRIDE:
P0A8F4
PRODB:
PRO_000024162
REFSEQ:
NP_416570
SMR:
P0A8F4
UNIPROT:
P0A8F4


Operon      
Name: udk-dcd         
Operon arrangement:
Transcription unit        Promoter
dcd
udk-dcd


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2402 2142279 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Neuhard J., Tarpo L., 1993, Location of the udk gene on the physical map of Escherichia coli., J Bacteriol 175(17):5742-3

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB