RegulonDB RegulonDB 10.10: Gene Form
   

yidJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yidK yidJ yidL yidI ysdC RcsB-BglJ terminator yidLp yidLp

Gene      
Name: yidJ    Texpresso search in the literature
Synonym(s): ECK3669, EG11705, b3678
Genome position(nucleotides): 3856911 <-- 3858404 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.01
External database links:  
ASAP:
ABE-0012024
ECHOBASE:
EB1656
ECOLIHUB:
yidJ
OU-MICROARRAY:
b3678
STRING:
511145.b3678
COLOMBOS: yidJ


Product      
Name: putative sulfatase/phosphatase YidJ
Synonym(s): YidJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 57.295
Isoelectric point: 5.08
Motif(s):
 
Type Positions Sequence
4 -> 341 PNFLFVMTDTQATNMVGCYSGKPLNTQNIDSLAAEGIRFNSAYTCSPVCTPARAGLFTGIYANQSGPWTNNVAPGKNISTMGRYFKDAGYHTCYIGKWHLDGHDYFGTGECPPEWDADYWFDGANYLSELTEKEISLWRNGLNSVEDLQANHIDETFTWAHRISNRAVDFLQQPARADEPFLMVVSYDEPHHPFTCPVEYLEKYADFYYELGEKAQDDLANKPEHHRLWAQAMPSPVGDDGLYHHPLYFACNDFVDDQIGRVINALTPEQRENTWVIYTSDHGEMMGAHKLISKGAAMYDDITRIPLIIRSPQGERRQVDTPVSHIDLLPTMMALADI
385 -> 439 VTDDFKLVLNLFTSDELYDRRNDPNEMHNLIDDIRFADVRSKMHDALLDYMDKIR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004065 - arylsulfatase activity
GO:0008484 - sulfuric ester hydrolase activity
Note(s): Note(s): ...[more].
Reference(s): [1] Mukhopadhyay S., et al., 1997
External database links:  
ECOCYC:
EG11705-MONOMER
ECOLIWIKI:
b3678
INTERPRO:
IPR032506
INTERPRO:
IPR024607
INTERPRO:
IPR017850
INTERPRO:
IPR000917
MODBASE:
P31447
PFAM:
PF00884
PFAM:
PF16347
PRIDE:
P31447
PROSITE:
PS00149
PROSITE:
PS00523
REFSEQ:
NP_418134
SWISSMODEL:
P31447
UNIPROT:
P31447


Operon      
Name: yidKJ         
Operon arrangement:
Transcription unit        Promoter
yidKJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Mukhopadhyay S., Schellhorn HE., 1997, Identification and characterization of hydrogen peroxide-sensitive mutants of Escherichia coli: genes that require OxyR for expression., J Bacteriol 179(2):330-8


RegulonDB