RegulonDB RegulonDB 11.1: Gene Form

ybfE gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

ybfF fldA ybfE LexA SoxS ybfEp ybfEp fldAp fldAp TSS_821 TSS_821

Name: ybfE    Texpresso search in the literature
Synonym(s): ECK0673, EG11775, b0685
Genome position(nucleotides): 711605 <-- 711898
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: ribbon-helix-helix domain-containing protein YbfE
Synonym(s): LexA-regulated protein, YbfE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.28
Isoelectric point: 10.847
Type Positions Sequence Comment
1 -> 30 MAKEQTDRTTLDLFAHERRPGRPKTNPLSR UniProt: Disordered; Sequence Annotation Type: region of interest.


Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  

Name: ybfE         
Operon arrangement:
Transcription unit        Promoter

Transcriptional Regulation      
Display Regulation             
Repressed by: LexA

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_821 711001 reverse nd [RS-EPT-CBR] [1]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
