RegulonDB RegulonDB 10.9: Gene Form
   

fcl gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gmd fcl gmm wcaI

Gene      
Name: fcl    Texpresso search in the literature
Synonym(s): ECK2046, EG11788, b2052, wcaG, yefB
Genome position(nucleotides): 2126225 <-- 2127190 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.42
External database links:  
ASAP:
ABE-0006801
ECHOBASE:
EB1736
ECOLIHUB:
fcl
OU-MICROARRAY:
b2052
STRING:
511145.b2052
COLOMBOS: fcl


Product      
Name: GDP-L-fucose synthase
Synonym(s): Fcl, WcaG, YefB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.141
Isoelectric point: 6.883
Motif(s):
 
Type Positions Sequence
6 -> 228 VFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELA
255 -> 256 EL
136 -> 136 Y
140 -> 140 K
10 -> 16 GHRGMVG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  5 - cell processes --> 5.5 - adaptations --> 5.5.5 - dessication
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
  6 - cell structure --> 6.7 - capsule (M and K antigens)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016853 - isomerase activity
GO:0016491 - oxidoreductase activity
GO:0050577 - GDP-L-fucose synthase activity
GO:0042803 - protein homodimerization activity
GO:0070401 - NADP+ binding
biological_process GO:0008152 - metabolic process
GO:0009226 - nucleotide-sugar biosynthetic process
GO:0009242 - colanic acid biosynthetic process
GO:0055114 - oxidation-reduction process
GO:0042351 - 'de novo' GDP-L-fucose biosynthetic process
External database links:  
ECOCYC:
FCL-MONOMER
ECOLIWIKI:
b2052
INTERPRO:
IPR036291
INTERPRO:
IPR001509
INTERPRO:
IPR028614
MODBASE:
P32055
PDB:
1BWS
PDB:
1GFS
PDB:
1FXS
PDB:
1E7S
PDB:
1E7R
PDB:
1BSV
PDB:
1E6U
PDB:
1E7Q
PFAM:
PF01370
PRIDE:
P32055
REFSEQ:
NP_416556
SMR:
P32055
UNIPROT:
P32055


Operon      
Name: wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC         
Operon arrangement:
Transcription unit        Promoter
wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB