RegulonDB RegulonDB 10.8: Gene Form
   

mobB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mobA mobB yihD rrfA CpxR mobAp2 mobAp2 yihDp yihDp TSS_4525 (cluster) TSS_4525 (cluster) mobAp1 mobAp1 TSS_4524 TSS_4524

Gene      
Name: mobB    Texpresso search in the literature
Synonym(s): ECK3848, EG11828, b3856, yihC
Genome position(nucleotides): 4040906 <-- 4041433 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.67
External database links:  
ASAP:
ABE-0012591
ECHOBASE:
EB1775
OU-MICROARRAY:
b3856
PortEco:
mobB
STRING:
511145.b3856
COLOMBOS: mobB


Product      
Name: molybdopterin-guanine dinucleotide biosynthesis adaptor protein
Synonym(s): MobB, YihC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.363
Isoelectric point: 5.283
Motif(s):
 
Type Positions Sequence
2 -> 175 AGKTMIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHDMDVDKPGKDSYELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQKQNG
10 -> 144 LAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHDMDVDKPGKDSYELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASD
51 -> 54 DKPG
17 -> 21 GTGKT
100 -> 103 SKLD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006777 - Mo-molybdopterin cofactor biosynthetic process
External database links:  
DIP:
DIP-10234N
ECOCYC:
EG11828-MONOMER
ECOLIWIKI:
b3856
INTERPRO:
IPR004435
INTERPRO:
IPR027417
MINT:
MINT-1264474
MODBASE:
P32125
PDB:
1NP6
PDB:
1P9N
PFAM:
PF03205
PRIDE:
P32125
PRODB:
PRO_000023266
REFSEQ:
NP_418293
SMR:
P32125
UNIPROT:
P32125


Operon      
Name: mobAB         
Operon arrangement:
Transcription unit        Promoter
mobAB
mobAB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4524 4041041 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4525 (cluster) 4042047 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB