RegulonDB RegulonDB 10.10: Gene Form
   

yihI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hemN yihI csrC terminator TSS_4545 TSS_4545 hemNp hemNp TSS_4543 TSS_4543 yihIp yihIp csrCp csrCp

Gene      
Name: yihI    Texpresso search in the literature
Synonym(s): ECK3859, EG11835, b3866
Genome position(nucleotides): 4051347 --> 4051856 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.35
External database links:  
ASAP:
ABE-0012626
ECHOBASE:
EB1781
ECOLIHUB:
yihI
OU-MICROARRAY:
b3866
STRING:
511145.b3866
COLOMBOS: yihI


Shine dalgarno      
Sequence: aacggctaaaAGACGAaccattATG


Product      
Name: Der GTPase-activating protein YihI
Synonym(s): GAP-like protein that activates GTPase activity of Der, YihI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.059
Isoelectric point: 6.825
Motif(s):
 
Type Positions Sequence
135 -> 135 R
17 -> 45 RRKTREELDQEARDRKRQKKRRGHAPGSR
14 -> 166 AKARRKTREELDQEARDRKRQKKRRGHAPGSRAAGGNTTSGSKGQNAPKDPRIGSKTPIPLGVTEKVTKQHKPKSEKPMLSPQAELELLETDERLDALLERLEAGETLSAEEQSWVDAKLDRIDELMQKLGLSYDDDEEEEEDEKQEDMMRLL
164 -> 164 R
1 -> 45 MKPSSSNSRSKGHAKARRKTREELDQEARDRKRQKKRRGHAPGSR

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0005096 - GTPase activator activity
biological_process GO:0042254 - ribosome biogenesis
GO:0043547 - positive regulation of GTPase activity
GO:0090071 - negative regulation of ribosome biogenesis
External database links:  
DIP:
DIP-47963N
ECOCYC:
EG11835-MONOMER
ECOLIWIKI:
b3866
INTERPRO:
IPR007336
PFAM:
PF04220
PRIDE:
P0A8H6
REFSEQ:
NP_418302
UNIPROT:
P0A8H6


Operon      
Name: yihI         
Operon arrangement:
Transcription unit        Promoter
yihI


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4543 4051320 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4545 4052097 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB