RegulonDB RegulonDB 10.9: Gene Form
   

yihV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yihV yihU csqR CRP CsqR csqRp csqRp yihVp1 yihVp1 yihUp5 yihUp5 yihVp3 yihVp3 yihUp4 yihUp4 yihUp3 yihUp3 yihUp2 yihUp2 yihUp1 yihUp1 yihVp6 yihVp6

Gene      
Name: yihV    Texpresso search in the literature
Synonym(s): ECK3876, EG11848, b3883, squV
Genome position(nucleotides): 4073739 --> 4074635 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.63
Note(s):
External database links:  
ASAP:
ABE-0012681
ECHOBASE:
EB1794
ECOLIHUB:
yihV
OU-MICROARRAY:
b3883
STRING:
511145.b3883
COLOMBOS: yihV


Product      
Name: 6-deoxy-6-sulfofructose kinase
Synonym(s): SquV, YihV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.728
Isoelectric point: 4.698
Motif(s):
 
Type Positions Sequence
1 -> 286 MIRVACVGITVMDRIYYVEGLPTESGKYVARNYTEVGGGPAATAAVAAARLGAQVDFIGRVGDDDTGNSLLAELESWGVNTRYTKRYNQAKSSQSAIMVDTKGERIIINYPSPDLLPDAEWLEEIDFSQWDVVLADVRWHDGAKKAFTLARQAGVMTVLDGDITPQDISELVALSDHAAFSEPGLARLTGVKEMASALKQAQTLTNGHVYVTQGSAGCDWLENGGRQHQPAFKVDVVDTTGAGDVFHGALAVALATSGDLAESVRFASGVAALKCTRPGGRAGIPD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0061594 - 6-deoxy-6-sulfofructose kinase activity
biological_process GO:0016310 - phosphorylation
GO:0046835 - carbohydrate phosphorylation
GO:1902777 - 6-sulfoquinovose(1-) catabolic process
GO:0061720 - 6-sulfoquinovose(1-) catabolic process to glycerone phosphate and 3-sulfolactaldehyde
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11848-MONOMER
ECOLIWIKI:
b3883
INTERPRO:
IPR030877
INTERPRO:
IPR029056
INTERPRO:
IPR011611
INTERPRO:
IPR002139
INTERPRO:
IPR002173
MODBASE:
P32143
PFAM:
PF00294
PRIDE:
P32143
PRINTS:
PR00990
PROSITE:
PS00584
REFSEQ:
NP_418319
SMR:
P32143
UNIPROT:
P32143


Operon      
Name: yihV-csqR         
Operon arrangement:
Transcription unit        Promoter
yihV-csqR
yihW


Transcriptional Regulation      
Display Regulation             
Repressed by: CsqR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yihVp6 4073532 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yihVp3 4073661 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB