RegulonDB RegulonDB 10.9: Gene Form
   

yiiM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cpxA kdgT yiiM cpxR TSS_4593 TSS_4593 yiiMp4 yiiMp4 yiiMp5 yiiMp5

Gene      
Name: yiiM    Texpresso search in the literature
Synonym(s): ECK3903, EG11870, b3910
Genome position(nucleotides): 4102822 --> 4103496 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.04
External database links:  
ASAP:
ABE-0012769
ECHOBASE:
EB1816
ECOLIHUB:
yiiM
OU-MICROARRAY:
b3910
STRING:
511145.b3910
COLOMBOS: yiiM


Product      
Name: 2-amino-6-N-hydroxylaminopurine resistance protein
Synonym(s): YiiM, protein involved in base analog detoxification
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.343
Isoelectric point: 5.957
Motif(s):
 
Type Positions Sequence
169 -> 211 VTVQEAAAIAWHMPFDDDQYHRLLSAAGLSKSWTRTMQKRRLS
26 -> 163 IQVDGELMLTELGLEGDEQAEKKVHGGPDRALCHYPREHYLYWAREFPEQAELFVAPAFGENLSTDGLTESNVYMGDIFRWGEALIQVSQPRSPCYKLNYHFDISDIAQLMQNTGKVGWLYSVIAPGKVSADAPLELV
47 -> 159 KKVHGGPDRALCHYPREHYLYWAREFPEQAELFVAPAFGENLSTDGLTESNVYMGDIFRWGEALIQVSQPRSPCYKLNYHFDISDIAQLMQNTGKVGWLYSVIAPGKVSADAP

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0030170 - pyridoxal phosphate binding
GO:0030151 - molybdenum ion binding
GO:0042803 - protein homodimerization activity
GO:0043546 - molybdopterin cofactor binding
biological_process GO:0009636 - response to toxic substance
GO:0009407 - toxin catabolic process
External database links:  
DIP:
DIP-12512N
ECOCYC:
EG11870-MONOMER
ECOLIWIKI:
b3910
INTERPRO:
IPR011037
INTERPRO:
IPR005302
INTERPRO:
IPR005163
MODBASE:
P32157
PDB:
1O67
PDB:
5YHI
PDB:
1O65
PFAM:
PF03473
PFAM:
PF03475
PRIDE:
P32157
PROSITE:
PS51340
REFSEQ:
NP_418346
SMR:
P32157
UNIPROT:
P32157


Operon      
Name: yiiM         
Operon arrangement:
Transcription unit        Promoter
yiiM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yiiMp5 4102753 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yiiMp4 4102784 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_4593 4104614 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB