RegulonDB RegulonDB 10.9: Gene Form
   

sbmC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dacD yeeA sbmC CRP LexA TSS_2317 TSS_2317 TSS_2316 TSS_2316 sbmCp1 sbmCp1 sbmCp2 sbmCp2 yeeAp6 yeeAp6

Gene      
Name: sbmC    Texpresso search in the literature
Synonym(s): ECK2003, EG11892, b2009, dgi, gyrI, yeeB
Genome position(nucleotides): 2080789 <-- 2081262 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.26
External database links:  
ASAP:
ABE-0006670
ECHOBASE:
EB1838
ECOLIHUB:
sbmC
OU-MICROARRAY:
b2009
STRING:
511145.b2009
COLOMBOS: sbmC


Product      
Name: DNA gyrase inhibitor
Synonym(s): Dgi, GyrI, SbmC, YeeB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.081
Isoelectric point: 4.342
Motif(s):
 
Type Positions Sequence
89 -> 96 ITGGQYAV
1 -> 152 MNYEIKQEEKRTVAGFHLVGPWEQTVKKGFEQLMMWVDSKNIVPKEWVAVYYDNPDETPAEKLRCDTVVTVPGYFTLPENSEGVILTEITGGQYAVAVARVVGDDFAKPWYQFFNSLLQDSAYEMLPKPCFEVYLNNGAEDGYWDIEMYVAV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
  5 - cell processes --> 5.8 - SOS response
  8 - extrachromosomal --> 8.2 - plasmid related
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0019899 - enzyme binding
GO:0008657 - DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) inhibitor activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:2000104 - negative regulation of DNA-dependent DNA replication
GO:2000372 - negative regulation of DNA topoisomerase (ATP-hydrolyzing) activity
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
External database links:  
DIP:
DIP-9862N
ECOCYC:
EG11892-MONOMER
ECOLIWIKI:
b2009
INTERPRO:
IPR029442
INTERPRO:
IPR024911
INTERPRO:
IPR011256
INTERPRO:
IPR010499
MINT:
P33012
MODBASE:
P33012
PDB:
1JYH
PFAM:
PF06445
PRIDE:
P33012
PRODB:
PRO_000022857
REFSEQ:
NP_416513
SMART:
SM00871
SMR:
P33012
UNIPROT:
P33012


Operon      
Name: sbmC         
Operon arrangement:
Transcription unit        Promoter
sbmC
sbmC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yeeAp6 2080661 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2316 2081326 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2317 2081705 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB