RegulonDB RegulonDB 10.9: Gene Form
   

yjaG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nfi yjaG hupA CRP Fis Fis Fis Fis yjaHp1 yjaHp1 TSS_4832 TSS_4832 TSS_4831 TSS_4831 TSS_4830 TSS_4830 TSS_4829 (cluster) TSS_4829 (cluster) hupAp hupAp TSS_4827 TSS_4827 TSS_4826 (cluster) TSS_4826 (cluster) TSS_4825 TSS_4825 TSS_4824 (cluster) TSS_4824 (cluster) TSS_4823 (cluster) TSS_4823 (cluster) yjaGp4 yjaGp4

Gene      
Name: yjaG    Texpresso search in the literature
Synonym(s): ECK3991, EG11916, b3999
Genome position(nucleotides): 4199504 --> 4200094 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.56
External database links:  
ASAP:
ABE-0013070
ECHOBASE:
EB1860
ECOLIHUB:
yjaG
OU-MICROARRAY:
b3999
STRING:
511145.b3999
COLOMBOS: yjaG


Product      
Name: DUF416 domain-containing protein YjaG
Synonym(s): YjaG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.613
Isoelectric point: 4.164
Motif(s):
 
Type Positions Sequence
5 -> 192 PIHLRLERLESWQHVTFMACLCERMYPNYAMFCQQTGFGDGQIYRRILDLIWETLTVKDAKVNFDSQLEKFEEAIPSADDFDLYGVYPAIDACVALSELVHSRLSGETLEHAVEVSKTSITTVAMLEMTQAGREMSDEELKENPAVEQEWDIQWEIFRLLAECEERDIELIKGLRADLREAGESNIGI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12528N
ECOCYC:
EG11916-MONOMER
ECOLIWIKI:
b3999
INTERPRO:
IPR007338
INTERPRO:
IPR023381
PFAM:
PF04222
PRIDE:
P32680
REFSEQ:
NP_418427
SMR:
P32680
UNIPROT:
P32680


Operon      
Name: yjaG         
Operon arrangement:
Transcription unit        Promoter
yjaG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjaGp4 4199373 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_4823 (cluster) 4199461 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4824 (cluster) 4199480 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4825 4199483 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4826 (cluster) 4199489 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4827 4199519 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4829 (cluster) 4200222 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4830 4200230 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4831 4200258 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4832 4200261 forward nd [RS-EPT-CBR] [2]
  promoter yjaHp1 4200511 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB