RegulonDB RegulonDB 10.9: Gene Form
   

yjaH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjaH zraP hupA CRP yjaHp1 yjaHp1

Gene      
Name: yjaH    Texpresso search in the literature
Synonym(s): ECK3993, EG11917, b4001
Genome position(nucleotides): 4200566 --> 4201261 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.45
External database links:  
ASAP:
ABE-0013079
ECHOBASE:
EB1861
ECOLIHUB:
yjaH
OU-MICROARRAY:
b4001
STRING:
511145.b4001
COLOMBOS: yjaH


Product      
Name: DUF1481 domain-containing protein YjaH
Synonym(s): YjaH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 26.317
Isoelectric point: 6.942
Motif(s):
 
Type Positions Sequence
42 -> 227 ASGFAEDQGAVRIWRKDSGDNVHLLAVFSPWRSGDTTTREYRWQGDNLTLININVYSKPPVNIRARFDDRGDLSFMQRESDGEKQQLSNDQIDLYRYRADQIRQISDALRQGRVVLRQGRWHAMEQTVTTCEGQTIKPDLDSQAIAHIERRQSRSSVDVSVAWLEAPEGSQLLLVANSDFCRWQPN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12529N
ECOCYC:
EG11917-MONOMER
ECOLIWIKI:
b4001
INTERPRO:
IPR010858
INTERPRO:
IPR016500
PFAM:
PF07356
PRIDE:
P32681
REFSEQ:
NP_418429
UNIPROT:
P32681


Operon      
Name: yjaH         
Operon arrangement:
Transcription unit        Promoter
yjaH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjaHp1 4200511 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB