RegulonDB RegulonDB 10.10: Gene Form
   

yjbB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

metH yjbB pepE terminator TSS_4845 TSS_4845 TSS_4844 TSS_4844 TSS_4843 TSS_4843 TSS_4842 TSS_4842 TSS_4841 TSS_4841 yjbBp yjbBp

Gene      
Name: yjbB    Texpresso search in the literature
Synonym(s): ECK4012, EG11919, b4020
Genome position(nucleotides): 4227731 --> 4229362 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.33
External database links:  
ASAP:
ABE-0013143
ECHOBASE:
EB1863
ECOLIHUB:
yjbB
OU-MICROARRAY:
b4020
STRING:
511145.b4020
COLOMBOS: yjbB


Product      
Name: putative inorganic phosphate export protein YjbB
Synonym(s): YjbB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 59.467
Isoelectric point: 7.951
Motif(s):
 
Type Positions Sequence
134 -> 154 GIGLGLILLALELIVQAVTPI
196 -> 216 ATLTAAGIISFPVALCLVIGA
48 -> 68 FCAGIGVTALVQSSNATTMLV
99 -> 119 ILTFDLSWLSPLLIFIGVIFF
159 -> 247 GVQVIFASLTGDILLDALIGAMFAIISYSSLAAVLLTATLTAAGIISFPVALCLVIGANLGSGLLAMLNNSAANAAARRVALGSLLFKL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005315 - inorganic phosphate transmembrane transporter activity
GO:0005436 - sodium:phosphate symporter activity
biological_process GO:0035435 - phosphate ion transmembrane transport
GO:0035725 - sodium ion transmembrane transport
GO:0044341 - sodium-dependent phosphate transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
EG11919-MONOMER
ECOLIWIKI:
b4020
INTERPRO:
IPR004633
INTERPRO:
IPR003841
PANTHER:
PTHR10010
PFAM:
PF02690
PRIDE:
P0AF43
REFSEQ:
NP_418444
SMR:
P0AF43
UNIPROT:
P0AF43


Operon      
Name: yjbB         
Operon arrangement:
Transcription unit        Promoter
yjbB


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4841 4227610 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4842 4227613 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4843 4227615 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4844 4229853 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4845 4229873 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB