RegulonDB RegulonDB 10.10: Gene Form
   

rluF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rluF pepE lysC5\' yjbD rluFp1 rluFp1 TSS_4846 TSS_4846 rluFp6 rluFp6 TSS_4845 TSS_4845 TSS_4844 TSS_4844

Gene      
Name: rluF    Texpresso search in the literature
Synonym(s): ECK4014, EG11921, b4022, yjbC
Genome position(nucleotides): 4230354 --> 4231226 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.55
External database links:  
ASAP:
ABE-0013150
ECHOBASE:
EB1865
ECOLIHUB:
rluF
OU-MICROARRAY:
b4022
STRING:
511145.b4022
COLOMBOS: rluF


Product      
Name: 23S rRNA pseudouridine2604 and tRNATyr pseudouridine35 synthase
Synonym(s): RluF, YjbC, ribosomal large subunit pseudouridine synthase F
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.477
Isoelectric point: 10.365
Motif(s):
 
Type Positions Sequence
7 -> 52 VRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVV
69 -> 195 LIALNKPVGIVSTTEDGERDNIVDFVNHSKRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPITEEFIRGMSAGVPILGTVTKKCKVKKEAPFVFRITLVQGLNRQIRRMCEH
105 -> 108 RLDK
107 -> 107 D
187 -> 190 RQIR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0106029 - tRNA pseudouridine synthase activity
GO:0120159 - rRNA pseudouridine synthase activity
GO:0016853 - isomerase activity
GO:0016866 - intramolecular transferase activity
GO:0003723 - RNA binding
GO:0009982 - pseudouridine synthase activity
biological_process GO:0009451 - RNA modification
GO:0001522 - pseudouridine synthesis
GO:0031119 - tRNA pseudouridine synthesis
GO:0008033 - tRNA processing
GO:0006364 - rRNA processing
GO:0000455 - enzyme-directed rRNA pseudouridine synthesis
Note(s): Note(s): ...[more].
Reference(s): [1] Addepalli B., et al., 2016
[2] Gustafsson C., et al., 1996
External database links:  
DISPROT:
DP02011
ECOCYC:
EG11921-MONOMER
ECOLIWIKI:
b4022
INTERPRO:
IPR036986
INTERPRO:
IPR042092
INTERPRO:
IPR020103
INTERPRO:
IPR018496
INTERPRO:
IPR006145
INTERPRO:
IPR002942
INTERPRO:
IPR000748
MODBASE:
P32684
PDB:
3DH3
PDB:
2GML
PFAM:
PF00849
PFAM:
PF01479
PRIDE:
P32684
PRODB:
PRO_000023781
PROSITE:
PS50889
PROSITE:
PS01149
REFSEQ:
NP_418446
SMART:
SM00363
SMR:
P32684
UNIPROT:
P32684


Operon      
Name: rluF         
Operon arrangement:
Transcription unit        Promoter
rluF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4844 4229853 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4845 4229873 reverse nd [RS-EPT-CBR] [3]
  promoter rluFp6 4230162 forward nd [ICWHO] [4]
  promoter TSS_4846 4230168 reverse nd [RS-EPT-CBR] [3]
  promoter rluFp1 4230309 forward nd [ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Addepalli B., Limbach PA., 2016, Pseudouridine in the Anticodon of Escherichia coli tRNATyr(QΨA) Is Catalyzed by the Dual Specificity Enzyme RluF., J Biol Chem 291(42):22327-22337

 [2] Gustafsson C., Reid R., Greene PJ., Santi DV., 1996, Identification of new RNA modifying enzymes by iterative genome search using known modifying enzymes as probes., Nucleic Acids Res 24(19):3756-62

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB