RegulonDB RegulonDB 10.9: Gene Form
   

aphA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aphA yjbQ yjbS GadE terminator anti-terminator terminator anti-terminator anti-anti-terminator TSS_4894 TSS_4894 TSS_4893 TSS_4893 yjbQp yjbQp TSS_4892 TSS_4892

Gene      
Name: aphA    Texpresso search in the literature
Synonym(s): ECK4047, EG11934, b4055, hobH, yjbP
Genome position(nucleotides): 4269414 --> 4270127 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.44
External database links:  
ASAP:
ABE-0013283
ECHOBASE:
EB1878
ECOLIHUB:
aphA
OU-MICROARRAY:
b4055
STRING:
511145.b4055
COLOMBOS: aphA


Product      
Name: acid phosphatase / phosphotransferase
Synonym(s): AphA, HobH, YjbP
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 26.104
Isoelectric point: 7.6
Motif(s):
 
Type Positions Sequence
137 -> 138 TG
1 -> 25 MRKITQAISAVCLLFALNSSAVALA
11 -> 220 VCLLFALNSSAVALASSPSPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKP
26 -> 237 SSPSPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004647 - phosphoserine phosphatase activity
GO:0003993 - acid phosphatase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
biological_process GO:0016311 - dephosphorylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9116N
ECOCYC:
APHA-MONOMER
ECOLIWIKI:
b4055
INTERPRO:
IPR023214
INTERPRO:
IPR010025
INTERPRO:
IPR005519
INTERPRO:
IPR036412
MODBASE:
P0AE22
PDB:
2HF7
PDB:
3CZ4
PDB:
2HEG
PDB:
2G1A
PDB:
2B8J
PDB:
2B82
PDB:
1RMY
PDB:
1RMT
PDB:
1RMQ
PDB:
1N9K
PDB:
1N8N
PFAM:
PF03767
PRIDE:
P0AE22
PRODB:
PRO_000022108
REFSEQ:
NP_418479
SMR:
P0AE22
SWISSMODEL:
P0AE22
UNIPROT:
P0AE22


Operon      
Name: aphA         
Operon arrangement:
Transcription unit        Promoter
aphA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4892 4269355 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4893 4270219 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4894 4270273 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB