RegulonDB RegulonDB 10.8: Gene Form
   

yjcF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yjcF    Texpresso search in the literature
Synonym(s): ECK4059, EG11941, b4066
Genome position(nucleotides): 4281783 <-- 4283075 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
32.95
External database links:  
ASAP:
ABE-0013325
ECHOBASE:
EB1885
OU-MICROARRAY:
b4066
PortEco:
yjcF
STRING:
511145.b4066
COLOMBOS: yjcF


Product      
Name: pentapeptide repeat-containing protein YjcF
Synonym(s): YjcF
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 49.378
Isoelectric point: 7.161
Motif(s):
 
Type Positions Sequence
268 -> 304 NLFRADLSFSKLDLINFEHADLSRVNLNKATLQNINL
163 -> 216 DLSNSNFAGCRLQNAIFQDCNMYKTNFNFAIMEKILFDNCILDDSNFAQIKMTD
309 -> 345 LFFTRLTNTFLEMVICTDSNMANVNFNNANLSNCHFN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12551N
ECOCYC:
EG11941-MONOMER
ECOLIWIKI:
b4066
INTERPRO:
IPR001646
MINT:
MINT-1238461
PFAM:
PF00805
PRIDE:
P32704
REFSEQ:
NP_418490
SMR:
P32704
UNIPROT:
P32704


Operon      
Name: yjcF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjcFp6 4283106 reverse Similarity to the consensus
Read more >
[ICWHO] [1]



RegulonDB