RegulonDB RegulonDB 10.9: Gene Form
   

nrfE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nrfE nrfD nrfG nrfF nrfC

Gene      
Name: nrfE    Texpresso search in the literature
Synonym(s): ECK4067, EG11948, b4074, yjcL
Genome position(nucleotides): 4291512 --> 4293170 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.32
External database links:  
ASAP:
ABE-0013350
CGSC:
34358
ECHOBASE:
EB1891
ECOLIHUB:
nrfE
OU-MICROARRAY:
b4074
STRING:
511145.b4074
COLOMBOS: nrfE


Product      
Name: putative cytochrome c-type biogenesis protein NrfE
Synonym(s): NrfE, YjcL, formate-dependent nitrite reductase; possible assembly function
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 61.295
Isoelectric point: 9.268
Motif(s):
 
Type Positions Sequence
26 -> 46 ILAQFALLLLAFGVLTYCFLI
403 -> 543 ALVAHAGVLLFAAGVVVSSVSRQEISLNLQPGQQVTLAGYTFRFECLDLQAKGNYTSEKAIVALFDHQQRIGELTPERRFYEARRQQMMEPSIRWNGIHDWYAVMGEKTGPDRYAFRLYVQSGVRWIWGGGLLMIAGALLS
455 -> 455 G
190 -> 190 C
301 -> 403 FALISLASLALYGWRARDGGPAVHFSGLSREMLILATLLLFCAVLLIVLVGTLYPMIYGLLGWGRLSVGAPYFNRATLPFGLLMLVVIVLATFVSGKRVQLPA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015232 - heme transmembrane transporter activity
GO:0020037 - heme binding
biological_process GO:0017004 - cytochrome complex assembly
GO:0015886 - heme transport
GO:0018378 - cytochrome c-heme linkage via heme-L-cysteine
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Eaves DJ., et al., 1998
External database links:  
ECOCYC:
EG11948-MONOMER
ECOLIWIKI:
b4074
INTERPRO:
IPR032523
INTERPRO:
IPR003568
INTERPRO:
IPR003570
INTERPRO:
IPR002541
INTERPRO:
IPR003567
PFAM:
PF01578
PFAM:
PF16327
PRIDE:
P32710
PRINTS:
PR01413
PRINTS:
PR01410
PRODB:
PRO_000023415
REFSEQ:
NP_418498
UNIPROT:
P32710


Operon      
Name: nrfABCDEFG         
Operon arrangement:
Transcription unit        Promoter
nrfABCDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, IHF, NarL, FlhDC, NarP
Repressed by: NsrR, IHF, NarL, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Eaves DJ., Grove J., Staudenmann W., James P., Poole RK., White SA., Griffiths I., Cole JA., 1998, Involvement of products of the nrfEFG genes in the covalent attachment of haem c to a novel cysteine-lysine motif in the cytochrome c552 nitrite reductase from Escherichia coli., Mol Microbiol 28(1):205-16


RegulonDB