RegulonDB RegulonDB 10.9: Gene Form
   

glf gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rfbX wbbH glf wbbI wbbJ rfbC TSS_2388 TSS_2388 rfcp11 rfcp11 rfcp7 rfcp7 rfcp10 rfcp10 rfcp8 rfcp8 TSS_2387 TSS_2387 TSS_2386 TSS_2386 TSS_2385 TSS_2385

Gene      
Name: glf    Texpresso search in the literature
Synonym(s): ECK2030, EG11981, b2036, yefE
Genome position(nucleotides): 2107226 <-- 2108329 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
35.6
External database links:  
ASAP:
ABE-0006755
ECHOBASE:
EB1924
ECOLIHUB:
glf
OU-MICROARRAY:
b2036
STRING:
511145.b2036
COLOMBOS: glf


Product      
Name: UDP-galactopyranose mutase
Synonym(s): Glf, YefE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.966
Isoelectric point: 7.132
Motif(s):
 
Type Positions Sequence
311 -> 311 Y
31 -> 32 EK
151 -> 151 Y
6 -> 72 IVGSGLFGAVCANELKKLNKKVLVIEKRNHIGGNAYTEDCEGIQIHKYGAHIFHTNDKYIWDYVNDL
181 -> 181 Y

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.1 - O antigen
  6 - cell structure --> 6.2 - murein
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0008767 - UDP-galactopyranose mutase activity
GO:0050660 - flavin adenine dinucleotide binding
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Lee R., et al., 1996
External database links:  
DIP:
DIP-6863N
ECOCYC:
GALPMUT-MONOMER
ECOLIWIKI:
b2036
INTERPRO:
IPR015899
INTERPRO:
IPR004379
MODBASE:
P37747
PDB:
1I8T
PFAM:
PF03275
PFAM:
PF13450
PRIDE:
P37747
PRODB:
PRO_000022775
REFSEQ:
NP_416540
SMR:
P37747
UNIPROT:
P37747


Operon      
Name: glf-wbbH         
Operon arrangement:
Transcription unit        Promoter
glf-rfc


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2385 2105457 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2386 2106618 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2387 2106661 reverse nd [RS-EPT-CBR] [2]
  promoter rfcp8 2107234 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter rfcp10 2107283 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter rfcp7 2107394 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter rfcp11 2107444 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2388 2108494 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Lee R., Monsey D., Weston A., Duncan K., Rithner C., McNeil M., 1996, Enzymatic synthesis of UDP-galactofuranose and an assay for UDP-galactopyranose mutase based on high-performance liquid chromatography., Anal Biochem 242(1):1-7

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB