RegulonDB RegulonDB 10.9: Gene Form
   

yehQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yehM yehQ yehP yehR

Gene      
Name: yehQ    Texpresso search in the literature
Synonym(s): ECK2114, EG12003, b2122
Genome position(nucleotides): 2209100 --> 2210944 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.85
External database links:  
ASAP:
ABE-0007015
ECHOBASE:
EB1941
ECOLIHUB:
yehQ
OU-MICROARRAY:
b2122
STRING:
316407.85675235
COLOMBOS: yehQ


Product      
Name: SWIM zinc finger domains-containing protein YehQ
Synonym(s): YehQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 67.73
Isoelectric point: 6.16
Motif(s):
 
Type Positions Sequence
55 -> 89 VRTQLANGQALKEAQCSCGANGMCRHRVMLVLSYQ
64 -> 88 ALKEAQCSCGANGMCRHRVMLVLSY
159 -> 183 SSIRFARCDCIEGTLCEHVVLAVQA
151 -> 185 SDVRFYSRSSIRFARCDCIEGTLCEHVVLAVQAFV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11905N
ECOCYC:
EG12003-MONOMER
ECOLIWIKI:
b2122
INTERPRO:
IPR007527
PFAM:
PF04434
PRIDE:
P33353
PROSITE:
PS50966
REFSEQ:
NP_416626
UNIPROT:
P33353


Operon      
Name: yehLMPQ         
Operon arrangement:
Transcription unit        Promoter
yehLMPQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB