RegulonDB RegulonDB 10.9: Gene Form
   

ccmE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ccmF ccmC ccmG ccmE ccmD ccmH ccmHp1 ccmHp1

Gene      
Name: ccmE    Texpresso search in the literature
Synonym(s): ECK2189, EG12055, b2197, yejS
Genome position(nucleotides): 2294901 <-- 2295380 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.54
External database links:  
ASAP:
ABE-0007271
CGSC:
36587
ECHOBASE:
EB1986
ECOLIHUB:
ccmE
OU-MICROARRAY:
b2197
STRING:
511145.b2197
COLOMBOS: ccmE


Product      
Name: periplasmic heme chaperone
Synonym(s): CcmE, YejS, cyctochrome c maturation protein E
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 17.698
Isoelectric point: 6.795
Motif(s):
 
Type Positions Sequence
4 -> 137 RRKNRLWIACAVLAGLALTIGLVLYALRSNIDLFYTPGEILYGKRETQQMPEVGQRLRVGGMVMPGSVQRDPNSLKVTFTIYDAEGSVDVSYEGILPDLFREGQGVVVQGELEKGNHILAKEVLAKHDENYTPP
130 -> 130 H
9 -> 30 LWIACAVLAGLALTIGLVLYAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0031237 - intrinsic component of periplasmic side of plasma membrane
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0020037 - heme binding
biological_process GO:1903607 - cytochrome c biosynthetic process
GO:0017004 - cytochrome complex assembly
GO:0017003 - protein-heme linkage
Note(s): Note(s): ...[more].
Reference(s): [1] Ahuja U., et al., 2006
[2] Enggist E., et al., 2003
[3] Harvat EM., et al., 2011
[4] Harvat EM., et al., 2009
[5] Harvat EM., et al., 2005
[6] Mavridou DA., et al., 2013
[7] Mavridou DA., et al., 2012
External database links:  
DIP:
DIP-9255N
DISPROT:
DP01729
ECOCYC:
CCME-MONOMER
ECOLIWIKI:
b2197
INTERPRO:
IPR004329
INTERPRO:
IPR036127
MINT:
P69490
MODBASE:
P69490
PANTHER:
PTHR34128
PDB:
1SR3
PFAM:
PF03100
PRIDE:
P69490
PRODB:
PRO_000022261
REFSEQ:
NP_416701
SMR:
P69490
UNIPROT:
P69490


Operon      
Name: napFDAGHBC-ccmABCDEFGH         
Operon arrangement:
Transcription unit        Promoter
napFDAGHBC-ccmABCDEFGH
napFDAGHBC-ccmABCDEFGH
napFDAGHBC
ccmABCDEFGH


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, ModE, FlhDC, NarP
Repressed by: NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ccmHp1 2292621 reverse Similarity to the consensus
Read more >
[ICWHO] [8]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Ahuja U., Thony-Meyer L., 2006, The membrane anchors of the heme chaperone CcmE and the periplasmic thioredoxin CcmG are functionally important., FEBS Lett 580(1):216-22

 [2] Enggist E., Schneider MJ., Schulz H., Thony-Meyer L., 2003, Biochemical and mutational characterization of the heme chaperone CcmE reveals a heme binding site., J Bacteriol 185(1):175-83

 [3] Harvat EM., Daltrop O., Sobott F., Moreau M., Barker PD., Stevens JM., Ferguson SJ., 2011, Metal and redox selectivity of protoporphyrin binding to the heme chaperone CcmE., Metallomics 3(4):363-8

 [4] Harvat EM., Redfield C., Stevens JM., Ferguson SJ., 2009, Probing the heme-binding site of the cytochrome c maturation protein CcmE., Biochemistry 48(8):1820-8

 [5] Harvat EM., Stevens JM., Redfield C., Ferguson SJ., 2005, Functional characterization of the C-terminal domain of the cytochrome c maturation protein CcmE., J Biol Chem 280(44):36747-53

 [6] Mavridou DA., Clark MN., Choulat C., Ferguson SJ., Stevens JM., 2013, Probing heme delivery processes in cytochrome c biogenesis System I., Biochemistry 52(41):7262-70

 [7] Mavridou DA., Stevens JM., Monkemeyer L., Daltrop O., di Gleria K., Kessler BM., Ferguson SJ., Allen JW., 2012, A pivotal heme-transfer reaction intermediate in cytochrome c biogenesis., J Biol Chem 287(4):2342-52

 [8] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB