RegulonDB RegulonDB 10.9: Gene Form
   

pgeF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rluD bamD pgeF ryfD clpB RyfD TSS_2929 TSS_2929 TSS_2928 TSS_2928 TSS_2927 TSS_2927 TSS_2926 TSS_2926 TSS_2925 TSS_2925 TSS_2924 TSS_2924 TSS_2923 TSS_2923 TSS_2922 TSS_2922 TSS_2921 (cluster) TSS_2921 (cluster) TSS_2920 (cluster) TSS_2920 (cluster) TSS_2919 TSS_2919 TSS_2918 TSS_2918 TSS_2917 TSS_2917 TSS_2916 (cluster) TSS_2916 (cluster) TSS_2915 TSS_2915 bamDp bamDp bamDp2 bamDp2 TSS_2914 TSS_2914 TSS_2913 TSS_2913 TSS_2912 TSS_2912 TSS_2911 TSS_2911 TSS_2910 TSS_2910 TSS_2909 TSS_2909 ryfDp ryfDp TSS_2908 (cluster) TSS_2908 (cluster) TSS_2907 TSS_2907 clpBp clpBp TSS_2905 TSS_2905 TSS_2904 (cluster) TSS_2904 (cluster)

Gene      
Name: pgeF    Texpresso search in the literature
Synonym(s): ECK2591, EG12097, b2593, yfiH
Genome position(nucleotides): 2734303 <-- 2735034 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.78
External database links:  
ASAP:
ABE-0008530
ECHOBASE:
EB2021
ECOLIHUB:
yfiH
MIM:
604302
OU-MICROARRAY:
b2593
STRING:
511145.b2593
COLOMBOS: pgeF


Product      
Name: polyphenol oxidase YfiH
Synonym(s): PgeF, YfiH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.339
Isoelectric point: 6.649
Motif(s):
 
Type Positions Sequence
27 -> 27 S
20 -> 241 STRIGGVSLPPYDSLNLGAHCGDNPDHVEENRKRLFAAGNLPSKPVWLEQVHGKDVLKLTGEPYASKRADASYSNTPGTVCAVMTADCLPVLFCNRAGTEVAAAHAGWRGLCAGVLEETVSCFADNPENILAWLGPAIGPRAFEVGGEVREAFMAVDAKASAAFIQHGDKYLADIYQLARQRLANVGVEQIFGGDRCTYTENETFFSYRRDKTTGRMASFIW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0017061 - S-methyl-5-thioadenosine phosphorylase activity
GO:0005507 - copper ion binding
GO:0016787 - hydrolase activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004731 - purine-nucleoside phosphorylase activity
GO:0004000 - adenosine deaminase activity
GO:0016682 - oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0042803 - protein homodimerization activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12097-MONOMER
ECOLIWIKI:
b2593
INTERPRO:
IPR038371
INTERPRO:
IPR011324
INTERPRO:
IPR003730
MODBASE:
P33644
PANTHER:
PTHR30616
PDB:
1Z9T
PFAM:
PF02578
PRIDE:
P33644
REFSEQ:
NP_417084
SMR:
P33644
UNIPROT:
P33644


Operon      
Name: rluD-pgeF         
Operon arrangement:
Transcription unit        Promoter
rluD-pgeF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2904 (cluster) 2734197 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2905 2734202 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2907 2734207 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2908 (cluster) 2734293 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2909 2735050 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2910 2735058 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2911 2735067 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2912 2735835 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2913 2735898 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2914 2735960 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2915 2736025 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2916 (cluster) 2736071 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2917 2736085 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2918 2736248 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2919 2736286 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2920 (cluster) 2736329 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2921 (cluster) 2736345 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2922 2736549 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2923 2736555 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2924 2736559 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2925 2736561 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2926 2736565 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2927 2736586 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2928 2736612 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2929 2736658 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB