RegulonDB RegulonDB 11.1: Gene Form
   

hofB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hofB hofC ppdD b0105 guaC

Gene      
Name: hofB    Texpresso search in the literature
Synonym(s): ECK0106, EG12106, b0107, hopB
Genome position(nucleotides): 115714 <-- 117099
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.46
External database links:  
ASAP:
ABE-0000370
ECHOBASE:
EB2030
ECOLIHUB:
hofB
OU-MICROARRAY:
b0107
STRING:
511145.b0107
COLOMBOS: hofB


Product      
Name: T2SSE family protein
Synonym(s): HofB, HopB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 50.615
Isoelectric point: 6.678
Motif(s):
 
Type Positions Sequence Comment
8 -> 9 AL UniProt: In Ref. 1; AAC36924..
35 -> 35 H UniProt: In Ref. 1; AAC36924..
88 -> 353 TLQSALEQRASDIHIEPADNAYRIRLRIDGVLHPLPDVSPDAGVALTARLKVLGNLDIAEHRLPQDGQFTVELAGNAVSFRIATLPCRGGEKVVLRLLQQVGQALDVNTLGMQPLQLADFAHALQQPQGLVLVTGPTGSGKTVTLYSALQKLNTADINICSVEDPVEIPIAGLNQTQIHPRAGLTFQGVLRALLRQDPDVIMIGEIRDGETAEIAIKAAQTGHLVLSTLHTNSTCETLVRLQQMGVARWMLSSALTLVIAQRLVRK
222 -> 229 GPTGSGKT UniProt: ATP.
355 -> 358 CPHC

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P36645
DIP:
DIP-9919N
ECOCYC:
EG12106-MONOMER
ECOLIWIKI:
b0107
INTERPRO:
IPR007831
INTERPRO:
IPR001482
INTERPRO:
IPR027417
MODBASE:
P36645
PFAM:
PF05157
PFAM:
PF00437
PRIDE:
P36645
PRODB:
PRO_000022910
PROSITE:
PS00662
REFSEQ:
NP_414649
SMR:
P36645
UNIPROT:
P36645


Operon      
Name: ppdD-hofBC         
Operon arrangement:
Transcription unit        Promoter
ppdD-hofBC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB