RegulonDB RegulonDB 11.1: Gene Form

nlpD gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

nlpD rpoS pcm umpG MqsA ArcA CRP ArcA CRP DksA-ppGpp DksA-ppGpp ppGpp terminator nlpDp1 nlpDp1 nlpDp2 nlpDp2 TSS_3034 TSS_3034 rpoSp rpoSp rpoSp4 rpoSp4 rpoSp3 rpoSp3 TSS_3032 TSS_3032 rpoSp2 rpoSp2 TSS_3031 TSS_3031 rpoSp1 rpoSp1 TSS_3030 TSS_3030 TSS_3029 TSS_3029 TSS_3028 TSS_3028 TSS_3027 TSS_3027 TSS_3026 TSS_3026

Name: nlpD    Texpresso search in the literature
Synonym(s): ECK2737, EG12111, b2742
Genome position(nucleotides): 2867614 <-- 2868753
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Shine dalgarno      
Sequence: caatttttccTGGGGGataAAT

Name: murein hydrolase activator NlpD
Synonym(s): NlpD, NlpD divisome associated factor, activates peptidoglycan hydrolase
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,outer membrane
Molecular weight: 40.149
Isoelectric point: 9.926
Type Positions Sequence Comment
29 -> 64 TSNPPAPVSSVNGNAPANTNSGMLITPPPKMGTTST N-terminal disordered linker that is implicated in OM targeting
30 -> 67 SNPPAPVSSVNGNAPANTNSGMLITPPPKMGTTSTAQQ UniProt: Disordered; Sequence Annotation Type: region of interest.
66 -> 97 QQPQIQPVQQPQIQATQQPQIQPVQPVAQQPV UniProt: 4 X 8 AA tandem repeats of Q-Q-P-Q-I-Q-P-V; Sequence Annotation Type: region of interest.


Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0032153 - cell division site
molecular_function GO:0004222 - metalloendopeptidase activity
biological_process GO:0051301 - cell division
GO:0006508 - proteolysis
GO:0007049 - cell cycle
GO:0009410 - response to xenobiotic stimulus
GO:0051345 - positive regulation of hydrolase activity
GO:0000920 - septum digestion after cytokinesis
Note(s): Note(s): ...[more].
Reference(s): [1] Rao S., et al., 2020
[2] Yang DC., et al., 2012
External database links:  

Name: nlpD-rpoS         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3026 2866797 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3027 2867113 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3028 2867456 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3029 2867493 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3030 2867551 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3031 2867572 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3032 2867645 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3034 2868128 reverse nd [RS-EPT-CBR] [3]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Rao S., Bates GT., Matthews CR., Newport TD., Vickery ON., Stansfeld PJ., 2020, Characterizing Membrane Association and Periplasmic Transfer of Bacterial Lipoproteins through Molecular Dynamics Simulations., Structure 28(4):475-487.e3

 [2] Yang DC., Tan K., Joachimiak A., Bernhardt TG., 2012, A conformational switch controls cell wall-remodelling enzymes required for bacterial cell division., Mol Microbiol 85(4):768-81

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
