RegulonDB RegulonDB 10.9: Gene Form
   

uraA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uraA hda upp TSS_2779 TSS_2779

Gene      
Name: uraA    Texpresso search in the literature
Synonym(s): ECK2493, EG12129, b2497
Genome position(nucleotides): 2618871 <-- 2620160 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.94
External database links:  
ASAP:
ABE-0008219
CGSC:
33043
ECHOBASE:
EB2050
ECOLIHUB:
uraA
OU-MICROARRAY:
b2497
STRING:
511145.b2497
COLOMBOS: uraA


Product      
Name: uracil:H+ symporter UraA
Synonym(s): UraA, uracil NCS2 transporter
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 45.06
Isoelectric point: 8.302
Motif(s):
 
Type Positions Sequence
290 -> 300 ENIGVMAITRV
302 -> 319 STWVIGGAAIFAILLSCV
16 -> 382 QTIPLSLQHLFAMFGATVLVPVLFHINPATVLLFNGIGTLLYLFICKGKIPAYLGSSFAFISPVLLLLPLGYEVALGGFIMCGVLFCLVSFIVKKAGTGWLDVLFPPAAMGAIVAVIGLELAGVAAGMAGLLPAEGQTPDSKTIIISITTLAVTVLGSVLFRGFLAIIPILIGVLVGYALSFAMGIVDTTPIINAHWFALPTLYTPRFEWFAILTILPAALVVIAEHVGHLVVTANIVKKDLLRDPGLHRSMFANGLSTVISGFFGSTPNTTYGENIGVMAITRVYSTWVIGGAAIFAILLSCVGKLAAAIQMIPLPVMGGVSLLLYGVIGASGIRVLIESKVDYNKAQNLILTSVILIIGVSGAKV
90 -> 110 ALGGFIMCGVLFCLVSFIVKK
179 -> 199 FLAIIPILIGVLVGYALSFAM

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
GO:0042803 - protein homodimerization activity
GO:0015210 - uracil transmembrane transporter activity
GO:0015505 - uracil:cation symporter activity
biological_process GO:0098721 - uracil import across plasma membrane
GO:0055085 - transmembrane transport
GO:0015857 - uracil transport
External database links:  
DIP:
DIP-11094N
ECOCYC:
URAA-MONOMER
ECOLIWIKI:
b2497
INTERPRO:
IPR029935
INTERPRO:
IPR006043
INTERPRO:
IPR006042
PANTHER:
PTHR11119:SF49
PDB:
3QE7
PFAM:
PF00860
PRIDE:
P0AGM7
PRODB:
PRO_000024187
PROSITE:
PS01116
REFSEQ:
NP_416992
SMR:
P0AGM7
UNIPROT:
P0AGM7


Operon      
Name: upp-uraA         
Operon arrangement:
Transcription unit        Promoter
upp-uraA


Transcriptional Regulation      
Display Regulation             
Activated by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2779 2618805 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB