RegulonDB RegulonDB 10.9: Gene Form
   

npr gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rapZ yrbL npr yrbL3\' mtgA SoxR SoxS PhoP BasR terminator TSS_3528 (cluster) TSS_3528 (cluster) yrbLp yrbLp TSS_3527 TSS_3527 TSS_3526 TSS_3526

Gene      
Name: npr    Texpresso search in the literature
Synonym(s): ECK3195, EG12147, b3206, ptsO, rpoR, yhbK
Genome position(nucleotides): 3347966 --> 3348238 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.08
External database links:  
ASAP:
ABE-0010524
ECHOBASE:
EB2067
ECOLIHUB:
npr
OU-MICROARRAY:
b3206
STRING:
511145.b3206
COLOMBOS: npr


Shine dalgarno      
Sequence: acgctggaaaAACGTAaaccATG


Product      
Name: phosphorelay protein NPr
Synonym(s): Npr, PtsO, RpoR, YhbK, phosphocarrier protein NPr
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.81
Isoelectric point: 4.024
Motif(s):
 
Type Positions Sequence
2 -> 90 TVKQTVEITNKLGMHARPAMKLFELMQGFDAEVLLRNDEGTEAEANSVIALLMLDSAKGRQIEVEATGPQEEEALAAVIALFNSGFDED
4 -> 84 KQTVEITNKLGMHARPAMKLFELMQGFDAEVLLRNDEGTEAEANSVIALLMLDSAKGRQIEVEATGPQEEEALAAVIALFN

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016772 - transferase activity, transferring phosphorus-containing groups
biological_process GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0006468 - protein phosphorylation
GO:0010243 - response to organonitrogen compound
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[APPHINH] Assay of protein purified to homogeneity from its native host
[IMP] Inferred from mutant phenotype
Reference(s): [1] Kim HJ., et al., 2011
[2] Lee CR., et al., 2005
[3] Powell BS., et al., 1995
[4] Rabus R., et al., 1999
External database links:  
ECOCYC:
EG12147-MONOMER
ECOLIWIKI:
b3206
INTERPRO:
IPR000032
INTERPRO:
IPR001020
INTERPRO:
IPR035895
INTERPRO:
IPR002114
MODBASE:
P0A9N0
PDB:
5T1N
PDB:
5T1O
PDB:
5T17
PFAM:
PF00381
PRIDE:
P0A9N0
PRINTS:
PR00107
PRODB:
PRO_000023635
PROSITE:
PS51350
PROSITE:
PS00589
PROSITE:
PS00369
REFSEQ:
NP_417673
SMR:
P0A9N0
UNIPROT:
P0A9N0


Operon      
Name: yrbG-kdsDC-lptCAB-rpoN-hpf-ptsN-rapZ-npr         
Operon arrangement:
Transcription unit        Promoter
yrbG-kdsD
yrbG-kdsDC-lptCAB
kdsC-lptCAB
kdsC-lptCAB
kdsC-lptCAB
lptAB
lptAB
lptB-rpoN-hpf-ptsN-yhbJ
rpoN-hpf-ptsN-yhbJ-npr


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3526 3347528 forward nd [RS-EPT-CBR] [5]
  promoter TSS_3527 3348325 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3528 (cluster) 3348425 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kim HJ., Lee CR., Kim M., Peterkofsky A., Seok YJ., 2011, Dephosphorylated NPr of the nitrogen PTS regulates lipid A biosynthesis by direct interaction with LpxD., Biochem Biophys Res Commun 409(3):556-61

 [2] Lee CR., Koo BM., Cho SH., Kim YJ., Yoon MJ., Peterkofsky A., Seok YJ., 2005, Requirement of the dephospho-form of enzyme IIANtr for derepression of Escherichia coli K-12 ilvBN expression., Mol Microbiol 58(1):334-44

 [3] Powell BS., Court DL., Inada T., Nakamura Y., Michotey V., Cui X., Reizer A., Saier MH., Reizer J., 1995, Novel proteins of the phosphotransferase system encoded within the rpoN operon of Escherichia coli. Enzyme IIANtr affects growth on organic nitrogen and the conditional lethality of an erats mutant., J Biol Chem 270(9):4822-39

 [4] Rabus R., Reizer J., Paulsen I., Saier MH., 1999, Enzyme I(Ntr) from Escherichia coli. A novel enzyme of the phosphoenolpyruvate-dependent phosphotransferase system exhibiting strict specificity for its phosphoryl acceptor, NPr., J Biol Chem 274(37):26185-91

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB