RegulonDB RegulonDB 10.9: Gene Form
   

ccmD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ccmF ccmC ccmB ccmE ccmD ccmG ccmA

Gene      
Name: ccmD    Texpresso search in the literature
Synonym(s): ECK2190, EG12169, b2198, yojM
Genome position(nucleotides): 2295377 <-- 2295586 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.14
External database links:  
ASAP:
ABE-0007273
CGSC:
36584
ECHOBASE:
EB2088
ECOLIHUB:
ccmD
OU-MICROARRAY:
b2198
STRING:
511145.b2198
COLOMBOS: ccmD


Product      
Name: cytochrome c maturation protein D
Synonym(s): CcmD, YojM, heme trafficking system protein D
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 7.745
Isoelectric point: 11.813
Motif(s):
 
Type Positions Sequence
14 -> 37 MGGYAFFVWLAVVMTVIPLVVLVV
15 -> 58 GGYAFFVWLAVVMTVIPLVVLVVHSVMQHRAILRGVAQQRAREA
18 -> 37 AFFVWLAVVMTVIPLVVLVV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0031235 - intrinsic component of the cytoplasmic side of the plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
biological_process GO:1903607 - cytochrome c biosynthetic process
GO:0017004 - cytochrome complex assembly
GO:0015886 - heme transport
Note(s): Note(s): ...[more].
Reference(s): [1] Schulz H., et al., 2000
External database links:  
ECOCYC:
EG12169-MONOMER
ECOLIWIKI:
b2198
INTERPRO:
IPR007078
PFAM:
PF04995
PRIDE:
P0ABM5
PRODB:
PRO_000022260
REFSEQ:
NP_416702
UNIPROT:
P0ABM5


Operon      
Name: napFDAGHBC-ccmABCDEFGH         
Operon arrangement:
Transcription unit        Promoter
napFDAGHBC-ccmABCDEFGH
napFDAGHBC-ccmABCDEFGH
napFDAGHBC
ccmABCDEFGH


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, NarP, FlhDC, ModE
Repressed by: NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Schulz H., Pellicioli EC., Thony-Meyer L., 2000, New insights into the role of CcmC, CcmD and CcmE in the haem delivery pathway during cytochrome c maturation by a complete mutational analysis of the conserved tryptophan-rich motif of CcmC., Mol Microbiol 37(6):1379-88


RegulonDB