RegulonDB RegulonDB 10.9: Gene Form
   

yjdC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dsbD yjdC pheU cutA Fis TSS_4933 TSS_4933 TSS_4932 TSS_4932 yjdCp yjdCp pheUp pheUp

Gene      
Name: yjdC    Texpresso search in the literature
Synonym(s): ECK4129, EG12176, b4135, cutA3
Genome position(nucleotides): 4362733 <-- 4363308 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.12
External database links:  
ASAP:
ABE-0013537
ECHOBASE:
EB2093
ECOLIHUB:
yjdC
OU-MICROARRAY:
b4135
STRING:
511145.b4135
COLOMBOS: yjdC


Product      
Name: putative DNA-binding transcriptional regulator YjdC
Synonym(s): YjdC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.931
Isoelectric point: 4.711
Motif(s):
 
Type Positions Sequence
1 -> 60 MQREDVLGEALKLLELQGIANTTLEMVAERVDYPLDELRRFWPDKEAILYDALRYLSQQI

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Reference(s): [1] Song JA., et al., 2009
External database links:  
DIP:
DIP-48209N
ECOCYC:
EG12176-MONOMER
ECOLIWIKI:
b4135
INTERPRO:
IPR001647
INTERPRO:
IPR009057
INTERPRO:
IPR036271
MODBASE:
P0ACU7
PRIDE:
P0ACU7
PROSITE:
PS50977
REFSEQ:
NP_418558
SMR:
P0ACU7
UNIPROT:
P0ACU7


Operon      
Name: dsbD-yjdC         
Operon arrangement:
Transcription unit        Promoter
yjdC
dsbD-yjdC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4932 4363473 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4933 4364237 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Song JA., Han KY., Park JS., Seo HS., Ahn KY., Lee J., 2009, Human G-CSF synthesis using stress-responsive bacterial proteins., FEMS Microbiol Lett 296(1):60-6

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB