RegulonDB RegulonDB 11.0: Gene Form
   

cspC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rlmA cspC yobF mntP  CyaR Cis-reg; thermoregulator anti-terminator terminator cspCp8 cspCp8 rlmAp9 rlmAp9

Gene      
Name: cspC    Texpresso search in the literature
Synonym(s): ECK1821, EG12204, b1823, msmB
Genome position(nucleotides): 1907226 <-- 1907435
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.67
External database links:  
ASAP:
ABE-0006070
CGSC:
35339
ECHOBASE:
EB2120
ECOLIHUB:
cspC
OU-MICROARRAY:
b1823
STRING:
511145.b1823
COLOMBOS: cspC


Product      
Name: transcription antiterminator and regulator of mRNA stability CspC
Synonym(s): CspA family stress protein CspC, CspC, MsmB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 7.402
Isoelectric point: 7.541
Motif(s):
 
Type Positions Sequence Comment
2 -> 69 AKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKGPAAVNVTAI UniProt: Cold shock-like protein CspC.
5 -> 68 KGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKGPAAVNVTA
6 -> 66 GQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKGPAAVNV UniProt: CSD.
7 -> 7 Q UniProt: In Ref. 8; AA sequence..

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
  5 - cell processes --> 5.5 - adaptations
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0016020 - membrane
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0003697 - single-stranded DNA binding
GO:0005515 - protein binding
GO:0003723 - RNA binding
GO:0042803 - protein homodimerization activity
GO:0051087 - chaperone binding
GO:0001072 - transcription antitermination factor activity, RNA binding
biological_process GO:0031564 - transcription antitermination
GO:0010468 - regulation of gene expression
GO:0034605 - cellular response to heat
GO:0060567 - negative regulation of DNA-templated transcription, termination
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IDA] Inferred from direct assay
[IMP] Inferred from mutant phenotype
Reference(s): [1] Bae W., et al., 2000
[2] Kram KE., et al., 2020
[3] Longo F., et al., 2016
[4] Perez-Rueda E., et al., 2004
[5] Seong W., et al., 2020
[6] Shenhar Y., et al., 2009
External database links:  
ALPHAFOLD:
P0A9Y6
DIP:
DIP-36183N
ECOCYC:
EG12204-MONOMER
ECOLIWIKI:
b1823
INTERPRO:
IPR019844
INTERPRO:
IPR002059
INTERPRO:
IPR012156
INTERPRO:
IPR012340
INTERPRO:
IPR011129
MODBASE:
P0A9Y6
PFAM:
PF00313
PRIDE:
P0A9Y6
PRINTS:
PR00050
PRODB:
PRO_000022340
PROSITE:
PS00352
PROSITE:
PS51857
REFSEQ:
NP_416337
SMART:
SM00357
SMR:
P0A9Y6
SWISSMODEL:
P0A9Y6
UNIPROT:
P0A9Y6


Operon      
Name: yobF-cspC         
Operon arrangement:
Transcription unit        Promoter
yobF-cspC
yobF-cspC


Transcriptional Regulation      
Display Regulation             
Repressed by: BtsR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rlmAp9 1907086 reverse nd [ICWHO] [7]
  promoter cspCp8 1907509 reverse nd [ICWHO] [7]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bae W., Xia B., Inouye M., Severinov K., 2000, Escherichia coli CspA-family RNA chaperones are transcription antiterminators., Proc Natl Acad Sci U S A 97(14):7784-9

 [2] Kram KE., Henderson AL., Finkel SE., 2020, Escherichia coli Has a Unique Transcriptional Program in Long-Term Stationary Phase Allowing Identification of Genes Important for Survival., mSystems 5(4)

 [3] Longo F., Motta S., Mauri P., Landini P., Rossi E., 2016, Interplay of the modified nucleotide phosphoadenosine 5'-phosphosulfate (PAPS) with global regulatory proteins in Escherichia coli: modulation of cyclic AMP (cAMP)-dependent gene expression and interaction with the HupA regulatory protein., Chem Biol Interact 259(Pt A):39-47

 [4] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [5] Seong W., Han GH., Lim HS., Baek JI., Kim SJ., Kim D., Kim SK., Lee H., Kim H., Lee SG., Lee DH., 2020, Adaptive laboratory evolution of Escherichia coli lacking cellular byproduct formation for enhanced acetate utilization through compensatory ATP consumption., Metab Eng 62:249-259

 [6] Shenhar Y., Rasouly A., Biran D., Ron EZ., 2009, Adaptation of Escherichi coli to elevated temperatures involves a change in stability of heat shock gene transcripts., Environ Microbiol 11(12):2989-97

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB