RegulonDB RegulonDB 10.9: Gene Form
   

ybeM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybeM crcB tatE tatEp3 tatEp3 crcBp4 crcBp4 crcBp3 crcBp3 TSS_753 TSS_753 TSS_752 TSS_752

Gene      
Name: ybeM    Texpresso search in the literature
Synonym(s): ECK0618, ECK0619, EG12208, b0625, b0626, b4581, ybeH
Type: Pseudo Gene
Genome position(nucleotides): 658031 --> 658818 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.19
External database links:  
ASAP:
ABE-0285113
ASAP:
ABE-0002150
ASAP:
ABE-0002148
ECHOBASE:
EB2954
ECHOBASE:
EB4324
ECOLIHUB:
ybeM_1
ECOLIHUB:
ybeM_2
ECOLIWIKI:
b0626
OU-MICROARRAY:
b0626
OU-MICROARRAY:
b0625
UNIPROT:
P0DP64
COLOMBOS: ybeM


Product      
Name: deamidated glutathione amidase, N-terminal fragment
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 11.228
Motif(s):
 
Type Positions Sequence
1 -> 75 MLVAAGQFAVTSVWEKNAEICASLMAQAAENDASLFALPEALLARDDHDADLSVKSAQLLEGEFLGLYGEKVNVT

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0006807 - nitrogen compound metabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12208-MONOMER
ECOLIWIKI:
b0625
INTERPRO:
IPR036526
UNIPROT:
P0DP63


Operon      
Name: ybeM         
Operon arrangement:
Transcription unit        Promoter
ybeM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_752 657964 forward nd [RS-EPT-CBR] [1]
  promoter TSS_753 657966 forward nd [RS-EPT-CBR] [1]
  promoter crcBp3 657998 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter crcBp4 658008 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter tatEp3 658871 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB