RegulonDB RegulonDB 10.9: Gene Form
   

ccp gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

treF gadA ccp nc8 OxyR OxyR FNR Fis TorR GadX GadW Fis GadX GadW Fis GadX GadW GadE-RcsB CRP GadX GadW GadX RcsB Fis GadX FNR TorR RutR ppGpp terminator TSS_4131 TSS_4131 treFp treFp yhjAp yhjAp TSS_4130 TSS_4130 gadAp gadAp TSS_4129 TSS_4129

Gene      
Name: ccp    Texpresso search in the literature
Synonym(s): ECK3503, EG12244, b3518, yhjA
Genome position(nucleotides): 3667791 <-- 3669188 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.43
External database links:  
ASAP:
ABE-0011493
ECHOBASE:
EB2155
ECOLIHUB:
yhjA
OU-MICROARRAY:
b3518
STRING:
511145.b3518
COLOMBOS: ccp


Product      
Name: cytochrome c peroxidase
Synonym(s): Ccp, YhjA, tri-heme CCP
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 51.571
Isoelectric point: 6.364
Motif(s):
 
Type Positions Sequence
4 -> 27 VSRITAIGLAGVAICYLGLSGYVW
340 -> 453 KKGYQLFKDNKCATCHGGIILGGRSFEPLGLKKDFNFGEITAADIGRMNVTKEERDKLRQKVPGLRNVALTAPYFHRGDVPTLDGAVKLMLRYQVGKELPQEDVDDIVAFLHSL
185 -> 332 QKVALGFALYHDPRLSADSTISCAHCHALNAGGVDGRKTSIGVGGAVGPINAPTVFNSVFNVEQFWDGRAATLQDQAGGPPLNPIEMASKSWDEIIAKLEKDPQLKTQFLEVYPQGFSGENITDAIAEFEKTLITPDSPFDKWLRGDE
18 -> 152 CYLGLSGYVWYHDNKRSKQADVQASAVSENNKVLGFLREKGCDYCHTPSAELPAYYYIPGAKQLMDYDIKLGYKSFNLEAVRAALLADKPVSQSDLNKIEWVMQYETMPPTRYTALHWAGKVSDEERAEILAWIA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.4 - energy production/transport
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0005887 - integral component of plasma membrane
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004130 - cytochrome-c peroxidase activity
GO:0004601 - peroxidase activity
GO:0020037 - heme binding
biological_process GO:0042542 - response to hydrogen peroxide
GO:0019645 - anaerobic electron transport chain
GO:0042743 - hydrogen peroxide metabolic process
GO:0055114 - oxidation-reduction process
GO:0098869 - cellular oxidant detoxification
Note(s): Note(s): ...[more].
Reference(s): [1] Constantinidou C., et al., 2006
External database links:  
ECOCYC:
EG12244-MONOMER
ECOLIWIKI:
b3518
INTERPRO:
IPR025992
INTERPRO:
IPR009056
INTERPRO:
IPR004852
INTERPRO:
IPR036909
MODBASE:
P37197
PFAM:
PF14376
PFAM:
PF03150
PFAM:
PF00034
PRIDE:
P37197
PROSITE:
PS51007
REFSEQ:
NP_417975
SMART:
SM01235
SMR:
P37197
UNIPROT:
P37197


Operon      
Name: ccp         
Operon arrangement:
Transcription unit        Promoter
yhjA


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, OxyR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4129 3667155 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4130 3668779 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4131 3670505 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Constantinidou C., Hobman JL., Griffiths L., Patel MD., Penn CW., Cole JA., Overton TW., 2006, A reassessment of the FNR regulon and transcriptomic analysis of the effects of nitrate, nitrite, NarXL, and NarQP as Escherichia coli K12 adapts from aerobic to anaerobic growth., J Biol Chem 281(8):4802-15

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB