RegulonDB RegulonDB 10.10: Gene Form
   

yiaK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yiaK plaR yiaL CRP YiaJ IHF IHF CRP yiaKp2 yiaKp2 yiaKp yiaKp yiaJp yiaJp

Gene      
Name: yiaK    Texpresso search in the literature
Synonym(s): ECK3564, EG12279, b3575
Genome position(nucleotides): 3742733 --> 3743731 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.05
External database links:  
ASAP:
ABE-0011682
ECHOBASE:
EB2187
ECOLIHUB:
yiaK
OU-MICROARRAY:
b3575
STRING:
511145.b3575
COLOMBOS: yiaK


Shine dalgarno      
Sequence: tcaaaaaaacAAGGAAgcctgggATG


Product      
Name: 2,3-diketo-L-gulonate reductase
Synonym(s): YiaK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.573
Isoelectric point: 4.978
Motif(s):
 
Type Positions Sequence
3 -> 330 VTFEQLKAAFNRVLISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQQLENGDIIPDAQPKRITSLGAIEQWDAQRSIGNLTAKKMMDRAIELAADHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICWTNSIAVMPPWGAKECRIGTNPLIVAIPSTPITMVDMSMSMFSYGMLEVNRLAGRQLPVDGGFDDEGNLTKEPGVIEKNRRILPMGYWKGSGMSIVLDMIATLLSDGASVAEVTQDNSDEYGISQIFIAIEVDKLIDGPTRDAKLQRIMDYVTSAERADENQAIRLPGHEFTTLLAENRRNGITVDDSVWAKIQ
168 -> 174 ITMVDMS
304 -> 306 GHE
224 -> 225 WK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0047559 - 3-dehydro-L-gulonate 2-dehydrogenase activity
GO:0070403 - NAD+ binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12279-MONOMER
ECOLIWIKI:
b3575
INTERPRO:
IPR043144
INTERPRO:
IPR043143
INTERPRO:
IPR036111
INTERPRO:
IPR023689
INTERPRO:
IPR003767
MODBASE:
P37672
PANTHER:
PTHR11091
PDB:
1NXU
PDB:
1S20
PFAM:
PF02615
PRIDE:
P37672
PRODB:
PRO_000022454
REFSEQ:
NP_418032
SMR:
P37672
UNIPROT:
P37672


Operon      
Name: yiaKLMNO-lyxK-sgbHUE         
Operon arrangement:
Transcription unit        Promoter
yiaKLMNO-lyx-sgbHUE
yiaKLMNO-lyx-sgbHUE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IHF
Repressed by: PlaR
Undetermined regulation CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB