RegulonDB RegulonDB 10.8: Gene Form
   

yiaW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aldB yiaV yiaW yiaU

Gene      
Name: yiaW    Texpresso search in the literature
Synonym(s): ECK3576, EG12291, b3587
Genome position(nucleotides): 3754105 <-- 3754428 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.6
External database links:  
ASAP:
ABE-0011714
ECHOBASE:
EB2199
OU-MICROARRAY:
b3587
PortEco:
yiaW
STRING:
511145.b3587
COLOMBOS: yiaW


Product      
Name: DUF3302 domain-containing protein YiaW
Synonym(s): YiaW
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 12.409
Isoelectric point: 7.936
Motif(s):
 
Type Positions Sequence
44 -> 66 IHVAGWVSLFTLHVIWPFLWIWA
7 -> 29 ALGVLIFVFLVIFYGIIILHDIP
3 -> 78 LDYFALGVLIFVFLVIFYGIIILHDIPYLIAKKRNHPHADAIHVAGWVSLFTLHVIWPFLWIWATLYRPERGWGMQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12291-MONOMER
ECOLIWIKI:
b3587
INTERPRO:
IPR011223
PFAM:
PF11742
PRIDE:
P0ADK4
REFSEQ:
NP_418044
SMR:
P0ADK4
UNIPROT:
P0ADK4


Operon      
Name: yiaWV         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB