RegulonDB RegulonDB 10.9: Gene Form
   

yibQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

envC waaH tdh yibQ NsrR PhoB PhoB anti-anti-terminator anti-terminator terminator yibDp1 yibDp1 TSS_4202 TSS_4202

Gene      
Name: yibQ    Texpresso search in the literature
Synonym(s): ECK3604, EG12298, b3614
Genome position(nucleotides): 3788101 --> 3789060 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.71
External database links:  
ASAP:
ABE-0011824
ECHOBASE:
EB2206
ECOLIHUB:
yibQ
OU-MICROARRAY:
b3614
STRING:
511145.b3614
COLOMBOS: yibQ


Product      
Name: divergent polysaccharide deacetylase domain-containing protein YibQ
Synonym(s): YibQ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 35.353
Isoelectric point: 10.16
Motif(s):
 
Type Positions Sequence
1 -> 23 MFPFRRNVLAFAALLALSSPVLA
24 -> 319 GKLAIVIDDFGYRPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLEKNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPATVRVLQQMVYNLPPDITLVKASSLLNEPQVDTSTPPKNAVPDAPRNPFRGVKLCKPKKPIEPVYANRFFEVLSESISQSTLIVYFQHQWQGWGKQPEAAKFNASAN
28 -> 238 IVIDDFGYRPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLEKNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPATVRVLQQMVYNLPPDITLVKASSLL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
biological_process GO:0005975 - carbohydrate metabolic process
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Reed JL., et al., 2003
External database links:  
ECOCYC:
EG12298-MONOMER
ECOLIWIKI:
b3614
INTERPRO:
IPR006837
INTERPRO:
IPR011330
PANTHER:
PTHR30105
PFAM:
PF04748
PRIDE:
P37691
REFSEQ:
NP_418071
SMR:
P37691
UNIPROT:
P37691


Operon      
Name: gpmM-envC-yibQ         
Operon arrangement:
Transcription unit        Promoter
gpmM-envC-yibQ
gpmM-envC-yibQ


Transcriptional Regulation      
Display Regulation             
Repressed by: Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4202 3786964 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Reed JL., Vo TD., Schilling CH., Palsson BO., 2003, An expanded genome-scale model of Escherichia coli K-12 (iJR904 GSM/GPR)., Genome Biol 4(9):R54

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB