RegulonDB RegulonDB 10.9: Gene Form
   

iscX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pepB fdx iscX terminator iscXp3 iscXp3 TSS_2824 TSS_2824 TSS_2823 TSS_2823

Gene      
Name: iscX    Texpresso search in the literature
Synonym(s): ECK2521, EG12311, b2524, yfhJ
Genome position(nucleotides): 2656536 <-- 2656736 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.25
External database links:  
ASAP:
ABE-0008309
ECHOBASE:
EB2217
ECOLIHUB:
iscX
OU-MICROARRAY:
b2524
STRING:
511145.b2524
COLOMBOS: iscX


Product      
Name: accessory iron-sulfur cluster assembly protein IscX
Synonym(s): IscX, YfhJ, regulator of iron-sulfur cluster assembly
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 7.732
Isoelectric point: 3.719
Motif(s):
 
Type Positions Sequence
43 -> 51 DDDPQASNE
58 -> 66 LLVWLDEAE
55 -> 55 E
3 -> 66 LKWTDSREIGEALYDAYPDLDPKTVRFTDMHQWICDLEDFDDDPQASNEKILEAILLVWLDEAE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0004857 - enzyme inhibitor activity
GO:0005506 - iron ion binding
GO:0008198 - ferrous iron binding
biological_process GO:0016226 - iron-sulfur cluster assembly
GO:0043086 - negative regulation of catalytic activity
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
Reference(s): [1] Kim JH., et al., 2014
[2] Nakamura M., et al., 1999
[3] Shi R., et al., 2010
[4] Tanaka N., et al., 2016
External database links:  
DIP:
DIP-48188N
ECOCYC:
EG12311-MONOMER
ECOLIWIKI:
b2524
INTERPRO:
IPR036762
INTERPRO:
IPR007479
PANTHER:
PTHR37532
PDB:
2BZT
PDB:
1UJ8
PFAM:
PF04384
PRIDE:
P0C0L9
PRODB:
PRO_000023033
REFSEQ:
NP_417019
SMR:
P0C0L9
UNIPROT:
P0C0L9


Operon      
Name: hscBA-fdx-iscX         
Operon arrangement:
Transcription unit        Promoter
hscBA-fdx-iscX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2823 2656567 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2824 2656727 reverse nd [RS-EPT-CBR] [5]
  promoter iscXp3 2656917 reverse Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kim JH., Bothe JR., Frederick RO., Holder JC., Markley JL., 2014, Role of IscX in iron-sulfur cluster biogenesis in Escherichia coli., J Am Chem Soc 136(22):7933-42

 [2] Nakamura M., Saeki K., Takahashi Y., 1999, Hyperproduction of recombinant ferredoxins in escherichia coli by coexpression of the ORF1-ORF2-iscS-iscU-iscA-hscB-hs cA-fdx-ORF3 gene cluster., J Biochem (Tokyo) 126(1):10-8

 [3] Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M., 2010, Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions., PLoS Biol 8(4):e1000354

 [4] Tanaka N., Kanazawa M., Tonosaki K., Yokoyama N., Kuzuyama T., Takahashi Y., 2016, Novel features of the ISC machinery revealed by characterization of Escherichia coli mutants that survive without iron-sulfur clusters., Mol Microbiol 99(5):835-48

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB