RegulonDB RegulonDB 10.9: Gene Form
   

erpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

clcA yadS erpA yadW IscR TSS_300 TSS_300 erpAp erpAp TSS_298 TSS_298 TSS_297 TSS_297

Gene      
Name: erpA    Texpresso search in the literature
Synonym(s): ECK0155, EG12332, b0156, yadR
Genome position(nucleotides): 176610 --> 176954 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.72
External database links:  
ASAP:
ABE-0000538
ECHOBASE:
EB2236
ECOLIHUB:
erpA
MIM:
616370
OU-MICROARRAY:
b0156
STRING:
511145.b0156
COLOMBOS: erpA


Product      
Name: iron-sulfur cluster insertion protein ErpA
Synonym(s): ErpA, YadR, essential respiratory protein A
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.1
Isoelectric point: 3.897
Motif(s):
 
Type Positions Sequence
9 -> 109 LEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCG
106 -> 106 C
108 -> 108 C
42 -> 42 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005198 - structural molecule activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0005506 - iron ion binding
biological_process GO:0106035 - protein maturation by [4Fe-4S] cluster transfer
GO:0009060 - aerobic respiration
GO:0009061 - anaerobic respiration
GO:0016226 - iron-sulfur cluster assembly
GO:0051604 - protein maturation
GO:0097428 - protein maturation by iron-sulfur cluster transfer
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48196N
ECOCYC:
EG12332-MONOMER
ECOLIWIKI:
b0156
INTERPRO:
IPR016092
INTERPRO:
IPR035903
INTERPRO:
IPR023063
INTERPRO:
IPR017870
INTERPRO:
IPR000361
MODBASE:
P0ACC3
PFAM:
PF01521
PRIDE:
P0ACC3
PRODB:
PRO_000022532
PROSITE:
PS01152
REFSEQ:
NP_414698
SMR:
P0ACC3
SWISSMODEL:
P0ACC3
UNIPROT:
P0ACC3


Operon      
Name: erpA         
Operon arrangement:
Transcription unit        Promoter
erpA


Transcriptional Regulation      
Display Regulation             
Repressed by: IscR


Regulation by small RNA    
  Display Regulation
small RNA ryhB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_297 176147 forward nd [RS-EPT-CBR] [1]
  promoter TSS_298 176558 forward nd [RS-EPT-CBR] [1]
  promoter TSS_300 176583 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB