RegulonDB RegulonDB 10.8: Gene Form
   

yagA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yagA yagE yagB yagEp8 yagEp8 yagEp3 yagEp3

Gene      
Name: yagA    Texpresso search in the literature
Synonym(s): ECK0268, EG12338, b0267
Genome position(nucleotides): 280829 <-- 281983 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
62.08
External database links:  
ASAP:
ABE-0000915
ECHOBASE:
EB2242
OU-MICROARRAY:
b0267
PortEco:
yagA
STRING:
511145.b0267
COLOMBOS: yagA


Product      
Name: CP4-6 prophage; integrase core domain-containing protein YagA
Synonym(s): CP4-6 prophage; putative DNA-binding transcriptional regulator, YagA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 43.769
Isoelectric point: 9.633
Motif(s):
 
Type Positions Sequence
137 -> 303 EHDAPNRLWQMDFKGHFPFGGGRCHPLTLLDDHSRFSLCLAHCTDERRETVQQQLVSVFERYGLPDRMTMDNGSPWGDTTGTWTALELWLMRLGIRVGHSRPYHPQTQGKLERFHRSLKAEVLQGKWFADSGELQRAFDHWRTVYNLERPHEALDMAVPGSRYQPSA
43 -> 116 TGYKWLQRWAQEGAAGLQDRPRIPHHSPNRSSDDITALLRMAHDRHERWGARKIKRWLEDQGHTMPAFSTVHNL
138 -> 257 HDAPNRLWQMDFKGHFPFGGGRCHPLTLLDDHSRFSLCLAHCTDERRETVQQQLVSVFERYGLPDRMTMDNGSPWGDTTGTWTALELWLMRLGIRVGHSRPYHPQTQGKLERFHRSLKAE

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
biological_process GO:0032196 - transposition
GO:0015074 - DNA integration
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11230N
ECOCYC:
EG12338-MONOMER
ECOLIWIKI:
b0267
INTERPRO:
IPR009057
INTERPRO:
IPR038965
INTERPRO:
IPR036397
INTERPRO:
IPR012337
INTERPRO:
IPR001584
MINT:
MINT-1304831
MODBASE:
P37007
PANTHER:
PTHR42648
PFAM:
PF00665
PRIDE:
P37007
PROSITE:
PS50994
REFSEQ:
NP_414801
SMR:
P37007
UNIPROT:
P37007


Operon      
Name: yagAB-insX         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yagEp3 282223 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yagEp8 282252 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB