RegulonDB RegulonDB 10.9: Gene Form
   

ybgD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybgQ gltA ybgD ybgDp9 ybgDp9

Gene      
Name: ybgD    Texpresso search in the literature
Synonym(s): ECK0708, EG12359, b0719
Genome position(nucleotides): 752229 <-- 752795 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.74
External database links:  
ASAP:
ABE-0002448
ECHOBASE:
EB2262
ECOLIHUB:
ybgD
OU-MICROARRAY:
b0719
STRING:
511145.b0719
COLOMBOS: ybgD


Product      
Name: putative fimbrial protein YbgD
Synonym(s): YbgD
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 19.838
Isoelectric point: 4.228
Motif(s):
 
Type Positions Sequence
24 -> 188 ADEGSGEIHFKGEVIEAPCEIHPEDIDKNIDLGQVTTTHINREHHSNKVAVDIRLINCDLPASDNGSGMPVSKVGVTFDSTAKTTGATPLLSNTSAGEATGVGVRLMDKNDGNIVLGSAAPDLDLDASSSEQTLNFFAWMEQIDNAVDVTAGEVTANATYVLDYK
31 -> 188 IHFKGEVIEAPCEIHPEDIDKNIDLGQVTTTHINREHHSNKVAVDIRLINCDLPASDNGSGMPVSKVGVTFDSTAKTTGATPLLSNTSAGEATGVGVRLMDKNDGNIVLGSAAPDLDLDASSSEQTLNFFAWMEQIDNAVDVTAGEVTANATYVLDYK
1 -> 23 MFKGQKTLAALAVSLLFTAPVYA

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
molecular_function GO:0005515 - protein binding
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Paradis-Bleau C., et al., 2014
[4] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
EG12359-MONOMER
ECOLIWIKI:
b0719
INTERPRO:
IPR000259
INTERPRO:
IPR008966
INTERPRO:
IPR036937
MODBASE:
P37909
PFAM:
PF00419
PRIDE:
P37909
REFSEQ:
NP_415247
SMR:
P37909
UNIPROT:
P37909


Operon      
Name: ybgD         
Operon arrangement:
Transcription unit        Promoter
ybgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybgDp9 752958 reverse Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [4] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB