RegulonDB RegulonDB 10.9: Gene Form
   

yfaE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nrdB inaA yfaE yoaM yfaEp1 yfaEp1 yfaEp2 yfaEp2 TSS_2515 TSS_2515 TSS_2514 TSS_2514

Gene      
Name: yfaE    Texpresso search in the literature
Synonym(s): ECK2228, EG12360, b2236
Genome position(nucleotides): 2348514 --> 2348768 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.08
External database links:  
ASAP:
ABE-0007390
ECHOBASE:
EB2263
ECOLIHUB:
yfaE
OU-MICROARRAY:
b2236
STRING:
511145.b2236
COLOMBOS: yfaE


Product      
Name: ferredoxin-like diferric-tyrosyl radical cofactor maintenance protein YfaE
Synonym(s): 2Fe-2S cluster-containing protein involved in diferric-tyrosyl radical cofactor maintenance, YfaE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.293
Isoelectric point: 4.711
Motif(s):
 
Type Positions Sequence
10 -> 77 GTQLLCQDEHPSLLAALESHNVAVEYQCREGYCGSCRTRLVAGQVDWIAEPLAFIQPGEILPCCCRAK
2 -> 84 ARVTLRITGTQLLCQDEHPSLLAALESHNVAVEYQCREGYCGSCRTRLVAGQVDWIAEPLAFIQPGEILPCCCRAKGDIEIEM

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
biological_process GO:0006464 - cellular protein modification process
GO:0030091 - protein repair
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
GO:0006124 - ferredoxin metabolic process
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Wu CH., et al., 2007
External database links:  
ECOCYC:
EG12360-MONOMER
ECOLIWIKI:
b2236
INTERPRO:
IPR001041
INTERPRO:
IPR036010
INTERPRO:
IPR012675
INTERPRO:
IPR006058
MODBASE:
P0ABW3
PFAM:
PF00111
PRIDE:
P0ABW3
PROSITE:
PS00197
PROSITE:
PS51085
REFSEQ:
NP_416739
SMR:
P0ABW3
UNIPROT:
P0ABW3


Operon      
Name: nrdAB-yfaE         
Operon arrangement:
Transcription unit        Promoter
nrdAB-yfaE
yfaE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, DnaA, ArgP, Fis
Repressed by: DnaA, H-NS, NrdR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2514 2347352 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2515 2347642 forward nd [RS-EPT-CBR] [2]
  promoter yfaEp2 2348338 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yfaEp1 2348341 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Wu CH., Jiang W., Krebs C., Stubbe J., 2007, YfaE, a ferredoxin involved in diferric-tyrosyl radical maintenance in Escherichia coli ribonucleotide reductase., Biochemistry 46(41):11577-88

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB