RegulonDB RegulonDB 10.9: Gene Form
   

intE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

intE lit ymfH xisE terminator TSS_1491 TSS_1491

Gene      
Name: intE    Texpresso search in the literature
Synonym(s): ECK1126, EG12370, b1140, int(Lambda), ycfI
Genome position(nucleotides): 1199679 <-- 1200806 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.77
External database links:  
ASAP:
ABE-0003836
ECHOBASE:
EB2273
ECOLIHUB:
intE
OU-MICROARRAY:
b1140
STRING:
511145.b1140
COLOMBOS: intE


Product      
Name: e14 prophage; putative integrase
Synonym(s): IntE, YcfI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.799
Isoelectric point: 10.628
Motif(s):
 
Type Positions Sequence
189 -> 375 ITRQRLSLEEWKKIFDIADATHRYMGNAMLLALVTGQRLGDISRMKFSDIWDDHLHVIQEKTGSKIAIPLSLRLNAINWSLRDVVARCRDYAVSAYLVHFFRSTSQAERGAQVKANTLTMNFSKARDLARIDWGEGSPATFHEQRSLSERLYKEQGLDTQKLLGHKTQQQTDRYHDDRGKGWSKVAL
1 -> 72 MAARPRKNNVSVPNLYPLYSRKVNKVYWRYKHPVTGKFHALGTNEAEAIAIATEANTRLAEQRTRQILAISD
82 -> 167 ITTSTWLDRYQAIQDDRLKSGDIRLNTYKQKAKPVSLLRERAGMKLISAVDVRDIAQLLDEYIAAGRPRMAQVVRSVLIDVFKEAQ
193 -> 364 RLSLEEWKKIFDIADATHRYMGNAMLLALVTGQRLGDISRMKFSDIWDDHLHVIQEKTGSKIAIPLSLRLNAINWSLRDVVARCRDYAVSAYLVHFFRSTSQAERGAQVKANTLTMNFSKARDLARIDWGEGSPATFHEQRSLSERLYKEQGLDTQKLLGHKTQQQTDRYHD

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0008907 - integrase activity
GO:0046982 - protein heterodimerization activity
biological_process GO:0044826 - viral genome integration into host DNA
GO:0006310 - DNA recombination
GO:0015074 - DNA integration
GO:0046718 - viral entry into host cell
GO:0075713 - establishment of integrated proviral latency
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10037N
ECOCYC:
EG12370-MONOMER
ECOLIWIKI:
b1140
INTERPRO:
IPR010998
INTERPRO:
IPR002104
INTERPRO:
IPR011010
INTERPRO:
IPR016177
INTERPRO:
IPR015094
INTERPRO:
IPR013762
MODBASE:
P75969
PFAM:
PF00589
PFAM:
PF09003
PRIDE:
P75969
PRODB:
PRO_000023027
PROSITE:
PS51898
PROSITE:
PS51900
REFSEQ:
NP_415658
SMR:
P75969
UNIPROT:
P75969


Operon      
Name: ymfH-xisE-intE         
Operon arrangement:
Transcription unit        Promoter
ymfH-xisE-intE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1491 1201113 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB